Loading...
The URL can be used to link to this page
Your browser does not support the video tag.
Home
My WebLink
About
1.00 General Application Materials
1 Royal Mini Storage West Glenwood Limited Impact Review Application West Glenwood Springs, Garfield County, Colorado Parcel ID# 2183-011-00-069 & 2183-011-00-070 Prepared April 21, 2022 Prepared by: The Land Studio, Inc. 365 River Bend Way Glenwood Springs, CO 81601 Phone 970-927-3690 landstudio2@comcast.net Prepared for: MMME WG LLC c/o Mark Gould P.O. Box 130 Glenwood Springs, CO 81601 970-379-1009 mark@gouldconstruction.com Royal Mini-Storage Wildlife Impact Report 4 Figure 2 – Royal Mini-Storage Plan Royal Mini Storage West Glenwood Limited Impact Review Application 2 2 Table of Contents APPLICATION TEAM .................................................................................................................................. 3 PRE-APPLICATION CONFERENCE SUMMARY ....................................................................................... 4 APPLICATION FORM ................................................................................................................................ 10 AUTHORIZATION LETTER ....................................................................................................................... 12 OWNERSHIP INFORMATION - 4-203.B.2 ................................................................................................ 13 PROPERTY OWNERS WITHIN 200’ AND MINERAL OWNERS AND LESSEES - 4-203.B ................... 14 MINERAL INTEREST OWNERS - 4-203.B ............................................................................................... 15 ADJACENT PROPERTY OWNERS MAP - 4-203.B ................................................................................. 16 PROJECT DESCRIPTION - 4-203.B ......................................................................................................... 17 VICINITY MAP - 4-203.C ........................................................................................................................... 18 SITE PLAN - 4-203.D ................................................................................................................................. 19 GRADING AND DRAINAGE PLAN - 4-203.E ........................................................................................... 19 LANDSCAPE PLAN - 4-203.F ................................................................................................................... 19 IMPACT ANALYSIS - 4-203.G .................................................................................................................. 19 TRAFFIC STUDY - 4-203.L ....................................................................................................................... 21 WATER SUPPLY AND DISTRIBUTION PLAN - 4-203.M ........................................................................ 21 WASTEWATER MANAGEMENT AND SYSTEM PLAN - 4-203.N ........................................................... 22 DIVISION 1. GENERAL APPROVAL STANDARDS ................................................................................. 22 7-101. ZONE DISTRICT USE REGULATIONS ................................................................................................ 22 7-102. COMPREHENSIVE PLAN AND INTERGOVERNMENTAL AGREEMENTS .................................................... 23 7-103. COMPATIBILITY .............................................................................................................................. 23 7-104. SOURCE OF WATER ....................................................................................................................... 23 7-105. CENTRAL WATER DISTRIBUTION AND WASTEWATER SYSTEMS ......................................................... 23 7-106. PUBLIC UTILITIES ........................................................................................................................... 24 7-107. ACCESS AND ROADWAYS ............................................................................................................... 24 7-108. USE OF LAND SUBJECT TO NATURAL HAZARDS ............................................................................... 24 7-109. FIRE PROTECTION ......................................................................................................................... 24 DIVISION 2. GENERAL RESOURCE PROTECTION STANDARDS. ...................................................... 24 7-201. AGRICULTURAL LANDS ................................................................................................................... 24 7-202. WILDLIFE HABITAT AREAS .............................................................................................................. 25 7-203. PROTECTION OF WATERBODIES ..................................................................................................... 25 7-204. DRAINAGE AND EROSION ............................................................................................................... 25 7-205. ENVIRONMENTAL QUALITY ............................................................................................................. 25 7-206. WILDFIRE HAZARDS ....................................................................................................................... 25 7-207. NATURAL AND GEOLOGIC HAZARDS ................................................................................................ 25 7-208. RECLAMATION ............................................................................................................................... 26 DIVISION 3. SITE PLANNING AND DEVELOPMENT STANDARDS ...................................................... 26 7-301. COMPATIBLE DESIGN ..................................................................................................................... 26 7-302. OFF-STREET PARKING AND LOADING STANDARDS ........................................................................... 26 7-303. LANDSCAPING STANDARDS ............................................................................................................ 26 7-304. LIGHTING STANDARDS ................................................................................................................... 26 7-305. SNOW STORAGE STANDARDS ........................................................................................................ 26 7-306. TRAIL AND WALKWAY STANDARDS .................................................................................................. 27 DIVISION 10. ADDITIONAL STANDARDS FOR INDUSTRIAL USES ..................................................... 27 7-1001. INDUSTRIAL USE STANDARDS ....................................................................................................... 27 EXHIBITS: .................................................................................................................................................. 28 Royal Mini Storage West Glenwood Limited Impact Review Application 3 3 Application Team Applicant MMME WG LLC c/o Mark Gould P.O. Box 130 Glenwood Springs, CO 81601 970-379-1009 mark@gouldconstruction.com Land Owner MMME WG LLC c/o Mark Gould P.O. Box 130 Glenwood Springs, CO 81601 970-379-1009 mark@gouldconstruction.com Civil Engineering Sopris Engineering, LLC Contact: Yancy Nichol 502 Main Street, Suite A-3 Carbondale, CO 81623 970.704.0311 Land Planning The Land Studio, Inc. Contact: Douglas J. Pratte 365 River Bend Way Glenwood Springs, Colorado 81601 970.927.3690 Water Attorney Michael J. Sawyer Harp Neu Hanlon, P.C. 201 14th Street, Suite 200 P.O. Drawer 2030 Glenwood Springs, CO 81601 970.928.2118 Geotechnical Engineer Kumar & Associates, Inc Contact: Steven L. Pawlak, P.E. 5020 County Road 154 Glenwood Springs, Colorado 81601 970.945.7988 Wildlife Ecologist SGM Contact: Eric Petterson 118 W Sixth St, Suite 200 Glenwood Springs, Colorado 81601 970.384.9017 Royal Mini Storage West Glenwood Limited Impact Review Application 4 4 Pre-Application Conference Summary Garfield County Community Development Department 108 8th Street, Suite 401 Glenwood Springs, CO 81601 (970) 945-8212 www.garfield-county.com PRE-APPLICATION CONFERENCE SUMMARY TAX PARCEL NUMBER: 2183-011-00-069 & 2183-011-00-070 DATE: 11/17/21 Updated 12/27/21 APPLICANT: Gould Self Storage CURRENT OWNER: MMME WG LLC CONTACT: Mark Gould PLANNER/REPRESENTATIVE: Doug Pratte, The Land Studio, Yancy Nichol, Sopris Engineering PRACTICAL LOCATION: Located approximately 1 mile west of the West Glenwood Springs 1-70 Interchange, off of Hwy 6 & 24. TYPE OF APPLICATION: Limited Impact Review -Land Use Change Permit for a Mini Storage Facility ZONING: Rural I. GENERAL PROJECT DESCRIPTION The Property Owner is proposing development of a mini storage facility on two parcels which total approximately 38 acres for the overall site. A limited impact review Land Use Change Permit would be required. The Applicant indicated a preliminary estimate of 118,400 sq.ft. of storage facility to be developed in three phases with a potential for two outdoor storage areas . The structures would be single story and served by a significant system of access driveways . The overall site has areas with slope in excess of 30% and those areas are intended to be avoided with the proposed development. Stormwater drainage, debris flow mitigation, grading plans, and plans for placement of fill on the site will be a significant considerations and important components of the submittal requirements . Grading work and some stockpiling of material is currently ongoing at the site. Royal Mini Storage West Glenwood Limited Impact Review Application 5 5 A summary of key considerations discussed includes : Traffic Study & Estimates, Fire Protection and Access , COOT Access Permitting/Requirements, Soil analysis and foundation recommendations/requirements, grading and stormwater detention , debris flow mitigation, status of Army Corp Permitting, lighting , screening and visual impacts, Comprehensive Plan Designations, office plans and potential inclusion of bathroom facilities and 50 ft. front yard setback off of 1-70. The Applicant indicated that they plan on hard surfaced access drives (potentially concrete) with a stormwater/manhole system for drainage. A fuel break for wildfire protection was discussed along with the required 100 ft . setback for outside storage. The property is located in the Glenwood Springs Urban Growth Area on the County Comprehensive Plan -Future Land Use Mapping . In the City 's Comprehensive Plan (current version) it is shown in the Low-Density Residential Use Category . Staff understands that the City is finalizing a new Comprehensive Plan and Mapping and noted that referrals to the City are required. Ideally such referrals and communication with the city should occur prior to a determination of completeness of any application to the County. Of note the project will be subject to payment of traffic impact fees at the time of building permit. Section 7-405 of the Land Use and Development Code should be consulted for additional information. II. REGULATORY PROVISIONS APPLICANT 15 REQUIRED TO ADDRESS • Garfield County Comprehensive Plan 2030 as amended. • Garfield County Land Use and Development Code as amended . • Rural Zone District -Use Table (Table 3-403). • Rural Zone District -Lot/Building Requirements (Table 3-201) • Review Process (Section 4-104) and Procedures (Section 4-101). • Table 4-102 Common Review Procedures and Required Notice . • Application Materials (Table 4-201 and Section 4-203). • Waivers, Section 4-118 (Standards) and Section 4-202 (Submittal Requirements). • Article 7, Standards -Division 1, 2 & 3 as applicable . • Section 7-1001 -Industrial Use Standards • Article 15, Definitions -Storage , Mini Ill. REVIEW PROCESS The Application will follow the Limited Impact Review Process contained in Sections 4-101 and 4-104 and in Table 4-102 (see attached flow chart): • Pre-application Conference • Submittal of Application (3 hard copies plus one digital PDF copy on CD or USB Stick) • Determination of Completeness, if Technically Complete the Applicant will be notified and the request scheduled for a public hearing before the Board of County Royal Mini Storage West Glenwood Limited Impact Review Application 6 6 Commissioners. If it is not technically complete the Applicant will be advised of the deficiencies and has 60 days to complete the application . • Once determined to be complete, the Application is sent out to referral agencies . • A Public hearing before the Board of County Commissioners is scheduled. • Four additional hardcopies of the Application are provided for the Board of County Commissioners review. • Applicant completes public notice for the public hearing (mailing, posting, and publication) a minimum of 30 days prior to the hearing. • Staff prepares a report including public and referral comments • Review and Action by the Board of County Commissioners at the public hearing. • The Board of County Commissioners action is formalized by a resolution. • If approved with conditions the Applicant must meet the conditions prior to issuance of the Land Use Change Permit. • The Applicant has one year to meet all conditions of approval. IV. SUBMITTAL REQUIREMENTS Application submittal requirements are detailed in Table 4-201 , and Section 4-203, Description of Submittal Requirements. Please use the summary provided below as a supplemental check list. □ General Application Materials (application forms , agreement to pay form, Statement of Authority for Trusts, corporations or LLC 's , authorization to represent, and payment of fees). □ Evidence of ownership such as a deed for the property and title work . o Narrative description of the proposal. App lication Submittal 3 Hard Copies 1 Digital PDF Copy (on CD or USB stick) Both the paper and the digital copy should be split into individual sections. Please refer to the list included in your pre-application conference summary for the submittal requirements that are appropriate for your application: □ List of property owners within 200 feet and any mineral rights owners on the property. A statement on how I h d · · d • General Application Materials minera owners were researc e Is require . • vic inity Map □ Vicinity Map (including the area generally within 3 miles of • site Plan • Grading and Drainage Plan the site). • Landscape Plan □ Site plan with information on proposed location of the • Impact Analysis • Traffic Study facilities, other existing structures , and significant features • Water Supply/Distribution Plan on the property including but not limited to topography, • Wastewater Management Plan • Article 7 Standards easements , utilities , ditches, access roads/driveways , wells , existing and proposed wastewater treatment systems (OWTS). o Grading and drainage Plans . Given the amount of impervious surface associated with the proposal , preliminary plans or engineering reports on grading and drainage are needed. Information on any retaining walls, detention facilities and related features needs to be provided. o Landscaping Plans Royal Mini Storage West Glenwood Limited Impact Review Application 7 7 D Impact Analysis . This section includes information on a variety of potential impacts including but not limited to hours of operation and mitigation for any nuisance impacts such as noise and lighting. Potential waivers regarding sections on environmental impacts on wildlife habitat may be requested . Please contact the staff planner for additional information on available resources and potential waiver requests . □ Legal access, physical access, and compliance with Roadway Standards Table 7-107. Demonstration of adequacy of the roadway and compliance with Roadway standards must be submitted . Waivers from roadway standards may be requested in accordance with the attached roadway waiver policy. A copy of any COOT access permits should also be provided or the status of any upgrades or amended permits provided . □ Traffic Study: The Traffic study needs to address Highway 6 & 24 impacts and access issues . D Water Supply Plan and supporting documentation including well permits , pump testing , and water quality testing . The plan should address fire protection demand and the proposed office use. A waiver to delay submittal of some documentation to be addressed as conditions of approval may be requested , however, based on the scale of the project provision of water supply plan information at the time of submittal is recommended . □ Wastewater treatment plans and supporting documentation . Needs to include information on the proposed office and OWTS . □ Information to address applicable sections of Article 7, Divisions 1, 2 , and 3, needs to be provided. Application formatting that addresses each section of Article 7 are recommended . □ Significant Article 7 Standards for this project are anticipated to include: zoning compliance, comprehensive plan compliance , compatibility, natural hazards, slopes , drainage and erosion, fire protection (including potential fire suppression sprinkler requirements), lighting, parking, access, signage, water and sanitation □ Section 7-1001 Industrial Use Standards and setbacks . □ It is recommended that the Applicant contact the Glenwood Springs Fire Protection District on potential fire protection requirements, COOT on access permit requirements, and the Garfield County Building Department on estimates of traffic impact fees prior to submittal. □ Zoning Compliance includes maximum lot coverage of .15 The proposed site plan and lot coverage will be addressed as part of the review process . □ Parking requirements for uses not listed in Table 7-302.A. are to be determined by the Director of Community Development. The Applicant needs to provide a detailed plan for parking and include a request for determination of the parking requirement as part of the review process . The Application submittal needs to include 3 hard copies of the entire Application and 1 Digital PDF Copy on a CD or USB Stick . Both the paper and digital copies should be split into individual sections . Please refer to the pre-application summary for submittal requirements that are appropriate for your Application. Any request for a waiver from standards shall be processed pursuant to Section 4-118 of the Land Use and Development Code . Submittal waiver requests should be consistent with Royal Mini Storage West Glenwood Limited Impact Review Application 8 8 the Pre-Application summary, and Section 4-202. Follow-up meetings with Planning Staff on potential waiver requests is recommended. V. APPLICATION REVIEW a. Review by : b. Public Hearing : c. Referral Agencies : Staff for completeness recommendation and referral agencies for additional technical review _ Director's Decision (with notice -not a public hearing) _ Planning Commission .JL Board of County Commissioners _ Board of Adjustment May include but are not limited to County Attorney, County Building Department , Glenwood Springs Fire Protection District, COOT, Division of Water Resources, City of Glenwood Springs, County Vegetation Manager, County Environmental Health, County Consulting Engineer. VI. APPLICATION REVIEW FEES a. Planning Review Fees : $ 400 b. Referral Agency Fees : $ TBD -consulting engineer/civil engineer fees c. Total Deposit: $ 400 (additional hours are billed at $40.50 /hour) VII. GENERAL APPLICATION PROCESSING The foregoing summary is advisory in nature only and is not binding on the County . The summary is based on current zoning, which is subject to change in the future, and upon factual representations that may or may not be accurate. This summary does not create a legal or vested right. The summary is valid for a six-month period, after which an update should be requested. The Applicant is advised that the Application submittal once accepted by the County becomes public information and will be available (including electronically) for review by the public. Proprietary information can be redacted from documents prior to submittal. Pre-application Summary Prepared by: Glenn Hartmann Principal Planner _ 12/27/21 __ Date Royal Mini Storage West Glenwood Limited Impact Review Application 9 9 Garfield County PAYMENT AGREEMENT FORM GARFIELD COUNTY ("COUNTY ) nd Property Own r ("APPLICANT"') _________ _ _____________________________ agree as fol ws: 1. T Applicant h,u submitted to the County n application for the following Project: __ _ 2. The Ap leant understands nd agr s ttiat Garfield County Resolution o . 201 60, as am nded, stablishes fe sch dule for each type application, and the guid Ii s for the dmlnlstration of the f structure. 3. The Applic;ant nd the County agr that because of the size, n tur or scope of th proposed p o · ct, it is not poSStbl at this time to 5eertaln the full extent of th eo Involved in pr-ocessing t e application. The Ap le nt gr l!"s to ma e p yment of the Base ~e, established for the Project, and tot r ft r permit addlt onal costs to be billed to th App iunt, T Applicant recs to ma e add" ·onal p.,ym nt upon notification by the County, when they r ne«ssary, as costs are Incurred . 4. The 8i.se Fee sh II be in addition to nd xclusive ofanycost for publication or cost of con ultins service det rm ;n d necessary by the Bo rd of County Commission rs fo the con id tion of an appl tlon or additional County staff time or expens not co11 d by th !la5e Fee. If actual recorded costs exceed the ini al B Fee, the Applicant shall pay additional bill ncs to the County to relmbu th County for th prootssing of the Pro ct The Applicant acknowledg s th.tt II billing shall be pa d prior to the final consideration by the County of any Land U Change or Division of Land . I hereby agree to pay all fHs r elated to tt,ls appfl ca on: Royal Mini Storage West Glenwood Limited Impact Review Application 10 10 Application Form Community Development Department 108 8th Street, Suite 401 Glenwood Springs, CO 81601 (970)945-8212 www.garfield-county.com LAND USE CHANGE PERMIT APPLICATION FORM TYPE OF APPLICATION Administrative Review Development in 100-Year Floodplain Limited Impact Review Development in 100-Year Floodplain Variance Major Impact Review Code Text Amendment Amendments to an Approved LUCP LIR MIR SUP Rezoning Zone District PUD PUD Amendment Minor Temporary Housing Facility Administrative Interpretation Vacation of a County Road/Public ROW Appeal of Administrative Interpretation Location and Extent Review Areas and Activities of State Interest Comprehensive Plan Amendment Accommodation Pursuant to Fair Housing Act Pipeline Development Variance Time Extension (also check type of original application) INVOLVED PARTIES Owner/Applicant Name: ________________________________________________ Phone: (______)_________________ Mailing Address: ______________________________________________________________________ City: _______________________________________ State: _______ Zip Code: ____________________ E-mail:_______________________________________________________________________________ Representative (Authorization Required) Name: ________________________________________________ Phone: (______)_________________ Mailing Address: ______________________________________________________________________ City: _______________________________________ State: _______ Zip Code: ____________________ E-mail:_______________________________________________________________________________ PROJECT NAME AND LOCATION Project Name: _____________________________________________________________________________________ Assessor’s Parcel Number: ___ ___ ___ ___ - ___ ___ ___ - ___ ___ - ___ ___ ___ Physical/Street Address: ________________________________________________________________ Legal Description: ______________________________________________________________________ _____________________________________________________________________________________ Zone District: ___________________________________ Property Size (acres): __________________ MMME WG LLC c/o Mark Gould 970 379-1009 PO Box 130 Glenwood Springs CO 81601 mark@gouldconstruction.com The Land Studio, Inc / Doug Pratte 970 927-3690 365 River Bend Way Glenwood Springs CO 81601 landstudio2@comcast.net Royal Mini Storage West Glenwood 49893 HWY 6 & 24 attached Rural 38.86 acres ✔ 2183-011-00-069 & 2183-011-00-070 DD □□ □ □ □!---------~~---------------1 D D D D D D Royal Mini Storage West Glenwood Limited Impact Review Application 11 11 PROJECT DESCRIPTION Existing Use: vac.a PropoHd Use (From U5e Table 3-403): _M_i_ni....;;S"'-tor;_ag~8 ... F_ac_l_l ty.,__ ____________ _ Description of Project: :ieprox. 118,400 sq . ft . of mini s10rage • sing o sto,y For Appeal of Administrative Interpretation please include: 1. The Ded5ion yoo are appea li ng . 2. The date the Ded sion Wll5 5tnt as ~cified In the notice (date mail d). 3. The nature of the d clslon and the 5pecl fl d ground for appe I. P1ease cite 5pec c code Section$ and/or relevant documentation to support your reque5t. 4 . The appropriat appeal fee of $250.00. s . Plea11e note a completed Appeal App lication and fe~ mun be received within 30 cal ndar day$ of t h e date f he flna l written Adm inistrative lnterp.:.:re ... ta:,:.tu,o...,n-'!.. __________ _ RE UEST FOR W_.MIERS _____ _ s.Jbmission Requ lr m ms D The A,pplicant reque Wa tv r of Subm ssion Requirem nts per Section 4 -2 02 . List; Section: ____________ Sect on: ____________ _ Section: Section: ____________ _ Wa iver of Stand rds D The Appl" nt Is r questi a Waiver of Standards per Section 118. List: Section:____________ ctlon: ____________ _ Sect on: SectJon : ____________ _ I have rea n d have provided the req\J lred attached information which is knowledge. Signature of Propeny Owner or Authortud Representatlv , TltJ~ Date OFFIOALUSEONLY Ftle Number. ____ -___ _ F Paid :$ __________ _ Royal Mini Storage West Glenwood Limited Impact Review Application 12 12 Authorization Letter Royal Mini torage West Glenwood Limited Impact Review Application We t Glenwood prings, Garfield County Colorado Parcel ID# 2183-011-00-069 & 2183-011-00-070 April 20, 2022 beryl Bow r Director of ommunity D ve lopment Garfield County, CO Re: Limited Impact R e view Applicatio11 Dear hery l: MMME ~ G L , c/o Mark Gould is the applican t and owner of the real prop rty which i th ubject of the Limited impact Re iew Application ubm.i tt e<I h r with . MMME LL hereby authorize Douglas Pra tt of The Land tu dio , Inc. to act in all r pects as the authorized representative of WG LLC to ubmit and pr e ute the abo e-fi renced appl ication. Very truly your , MMME \ L By:~~ ark Gould manag r Royal Mini Storage West Glenwood Limited Impact Review Application 13 13 Ownership Information - 4-203.B.2 See Title Commitment attached as an Exhibit to this Application. Royal Mini Storage West Glenwood Limited Impact Review Application 14 14 Property Owners within 200’ and Mineral Owners and Lessees - 4- 203.B 30 *DUÀHOG&RXQW\/DQG([SORUHU *DUÀHOG&RXQW\/DQG([SORUHU 3DUFHO 3K\VLFDO$GGUHVV 2ZQHU $FFRXQW1XP 0DLOLQJ$GGUHVV 1RWDYDLODEOH*/(1:22'635,1*6 67250.,1*+817,1*5$1&+//&5 &2817<52$'68,7(*/(1:22'635,1*6&2 +:<*/(1:22'635,1*6 '(9(55,&+$5'7+203621 55$5,7$1:$<'(19(5&2 1RWDYDLODEOH*/(1:22'635,1*6 000(:*//&5+,*+:$<*/(1:22'635,1*6&2 +:<*/(1:22'635,1*6 000(:*//&5 +,*+:$<*/(1:22'635,1*6&2 1RWDYDLODEOH1(:&$67/(%85($82)/$1'0$1$*(0(17 55,9(5)5217$*(52$'6,/7&2 +:<*/(1:22'635,1*6 $0,&+$8;/,0,7('3$571(56+,3///3 532%2;*/(1:22'635,1*6&2 52:1RWDYDLODEOHQXOO 52:1RWDYDLODEOHQXOO 30 *DUÀHOG&RXQW\/DQG([SORUHU *DUÀHOG&RXQW\/DQG([SORUHU 3DUFHO 3K\VLFDO$GGUHVV 2ZQHU $FFRXQW1XP 0DLOLQJ$GGUHVV +:<*/(1:22'635,1*6 '(9(55,&+$5'7+203621 55$5,7$1:$<'(19(5&2 1RWDYDLODEOH*/(1:22'635,1*6 000(:*//&5+,*+:$<*/(1:22'635,1*6&2 +:<*/(1:22'635,1*6 000(:*//&5 +,*+:$<*/(1:22'635,1*6&2 1RWDYDLODEOH1(:&$67/(%85($82)/$1'0$1$*(0(17 55,9(5)5217$*(52$'6,/7&2 52:1RWDYDLODEOHQXOO Parcel Physical Address Owner AccountNum MalllngAddress Physlcal Address Owner AccountNum Malling Address Royal Mini Storage West Glenwood Limited Impact Review Application 15 15 Mineral Interest Owners - 4-203.B Garfield County ERTIFJ TIO '0 Ml ERAL O\, ERRES R H This form ls to be comp/ ttd and submltttd with ony oppllcotion for o Land Use Change Permit. Mineral nterests may be severed from surf.ice right Interests in real property. C.R.S. § 24-65.S-1O1, tt seq, requires notific;a on to mineral owners when a landowner applies for an pplication for development from a local govemmel'lt. As wch, the landowner must re$earch the current own rs of m neral Int r :rts fM the property, The Garfield County Land Use and Development Code of l013 (•tuOC') Section 4-10l(E)(l)(b)(4} requi~ s written notice to owners of mineral ter su in the subject proptrty in accordanoe with C.R .S. § 24-65.5-101, et seq, •as such owners can be Id ntified throuah the records In the offica of the Cl rk and Recorder or As.sessor, or thro h oth r means.• Th s fonn Is proof of applicant's complf.ance with the Colorado Revised St:atu es and the LUDC. The under5l1ned appllcant cer1lf1.s that mlne1'111 owners have been researched for the sub)ect property as r~ulred pursuant to C.R .$.§ 24-6S.S·101, et seq, and Section 4-101 (EK1)(b)(4) of the Garfield County Land Use nd Development Code, as amended. As a result of that research, the undersigned applica nt certfflts the followfng (Pl-initiof an the blank line nelft to tht stotement that occurotefy reflects the rttuft of ,_,th}: _ I own the entire mlneral state relative to the subj~ property; or / M1 rals are owned by the partie$ li5ted below The nameund ddressesofany and all mineral owners td ntifi dare provided b low (attach add l on I pages as nece=rvl: Name of Mineral Owner Malling Address of Mlneral Owner I 11clulow1edge I reviewed C.R.S , t 24-65.S-101, tt seq, and I am In a>mpllanai with said statue and the woe. o&LdUJ Applicant's Signature Royal Mini Storage West Glenwood Limited Impact Review Application 16 16 Adjacent Property Owners Map - 4-203.B Royal Mini Storage West Glenwood Adjacent Property Owners Map Royal Mini Storage West Glenwood Limited Impact Review Application 17 17 Project Description - 4-203.B The proposed project is for a mini storage facility on two parcels which total approximately 38 acres for the overall site. The site is located near Storm King Mountain, north of I-70, east of mile marker 113. The Royal Mini Storage West Glenwood facility will contain approximately 118,400 sq. ft of storage to be developed in three phases with construction beginning in the fall of 2022 and opening for business in March of 2023. An outdoor storage area will be provided as part of the proposed storage facility and will be surrounded with an 8’screened fence. The buildings will all be single story. Access to the storage facility will be from Highway 6 & 24, the applicant does intend to provide improvements to the access. Information regarding traffic and an access permit is included in a traffic report included in this application. Two Employee housing units are proposed as part of this application, one is an existing residential home, the other will be a new residence. Each home will be approximately 1,500 sq. ft. Royal Mini Storage West Glenwood Limited Impact Review Application 18 18 Vicinity Map - 4-203.C SECTIO 1 TO SHIP 6 SOUTH . RANGE 90 ST . 6 h P . . Royal Mini Storage West Glenwood Limited Impact Review Application 19 19 Site Plan - 4-203.D A Conceptual Site and Drainage Plan has been included as an Exhibit to this Application. Grading and Drainage Plan - 4-203.E A Conceptual Site and Drainage Plan has been prepared by Sopris Engineering and is included as an Exhibit to this Application. Drainage and Erosion Control have been addressed in an Engineering Report prepared by Sopris Engineering which is included as an Exhibit to this Application. Landscape Plan - 4-203.F A Landscape Plan has been included as an Exhibit to this Application. Impact Analysis - 4-203.G 1. Adjacent Land Use. Existing use of adjacent property and neighboring properties within 1,500-foot radius. The neighboring properties to the west and north are BLM lands with the exception of one residence directly to the north of this property. The property to the east is Ami’s Acres Campground. The adjacent property to the south is I-70. The site plan shows all setbacks from the property boundaries. See Adjacent Property Owners Map as part of this application. 2. Site Features. A description of site features such as streams, areas subject to flooding, lakes, high ground water areas, topography, vegetative cover, climatology, and other features that may aid in the evaluation of the proposed development. A Rockfall study has been completed for the subject property however current development of the site proposes no new structures in the rockfall area. The property does contain some slopes of greater than 30%, but the proposed site development avoids construction in areas with slopes greater than 20% Royal Mini Storage West Glenwood Limited Impact Review Application 20 20 The property has experienced debris flow events in the past. A Mudflow report is included as part of the Sopris Engineering Report included as an Exhibit to this Application. 3. Soil Characteristics. A description of soil characteristics of the site that have a significant influence on the proposed use of the land. A Subsoil Study has been provided by Kumar & Associates, Inc. and is included as an Exhibit to this Application. 4. Geology and Hazard. A description of geologic characteristics of the area including any potential natural or manmade hazards, and a determination of what effect such factors would have on the proposed use of the land. A Subsoil Study has been provided by Kumar & Associates, Inc and is included as an Exhibit to this Application. 5. Groundwater and Aquifer Recharge Area. Evaluation of the relationship of the subject parcel to Floodplains, the nature of soils and subsoils and their ability to adequately support waste disposal, the Slope of the land, the effect of sewage effluents, and the pollution of surface Runoff, stream flow, and groundwater. A Subsurface Investigation for an OWTS was performed by All Service Septic in 2009 for the existing residence. The soils encountered at the time were reported to consist of clayey sand with scattered rock to the profile pit depth of 7-feet. Percolation testing resulted in rates ranging from 10 to 14 minutes per inch. The equivalent USDA soil classification would be a loamy sand soil type 1. The design capacity for the system was based on 450 gpd for a 3- bedroom residence. The system consists of a 1,000 gallon two- compartment tank followed by 3 gravel-less trenches providing 396 S.F. of infiltrative area. 6. Environmental impacts. Determination of the existing environmental conditions on the parcel to be developed and the effects of development on those conditions. No outside processing of materials will occur on site. Vehicle trips for the proposed storage facility will be minimal and the parking area will be paved to eliminate dust. No hazardous materials will be used or discharged into water from the proposed use. Minimal native vegetation exists within the proposed development area. The adjacent steep slopes on the north side of the property will remain undeveloped. Royal Mini Storage West Glenwood Limited Impact Review Application 21 21 Wastewater management has been addressed in section 4-203.N below. 7. Nuisance. Impacts on adjacent land from generation of vapor, dust, smoke, noise, glare or vibration or other emanations. The Applicant agrees to use non reflective building materials to eliminate glare and will follow Garfield County lighting standards to minimize impacts of exterior lighting on the surrounding neighborhood. Lighting will be downlight fixtures at the the bay doors. A lighting plan is included as an Exhibit in this Application. No dust, vapor, smoke, or noise will be created with this storage facility as all activity will be contained to the storage units and outdoor storage will only be for parked vehicles. 8. Hours of Operation. The Applicant shall submit information on the hours of operation of the proposed use. Mini Storage access hours are 6:00 a.m. to 10:00 p.m. daily. Traffic Study - 4-203.L A Traffic Summary has been completed by Sopris Engineering and is included as an Exhibit to this Application. The proposed development is to be accessed from the CDOT right-of-way of Highway 6 & 24. Since the access is within the CDOT right-of-way an Access Permit has been acquired from the state and is attached to Engineering Report. Both the County and State standards for the access are being met with the proposed design. Water Supply and Distribution Plan - 4-203.M The following information on Source of Water is from the Engineering Report completed by Sopris Engineering included as an Exhibit to this Application. The subject site currently has three domestic wells permitted through the site. The well permit numbers are 30751, 30752, 30753, and are labeled as Dever Well’s 1 through 3 respectively. The wells are permitted to have a combined maximum allowed usage of 0.44cfs for domestic and irrigation. 0.22cfs for domestic usage and 0.22cfs for irrigation purposes. Currently one well is serving the existing home on parcel #219301100070. The other two wells are located on parcel #218301100069. The proposed mini storage development will utilize the existing wells located on parcel 21830110069. These two wells will be utilized to serve the proposed employee house unit and supply water to the fire suppression tank. The fire Royal Mini Storage West Glenwood Limited Impact Review Application 22 22 suppression tank will be approximately 185,000 gallons of water. The site is anticipated to have trees for screening, but no ground cover, due to coordination with the fire department. The irrigation is expected to be no more than 5 acres to irrigate landscaping around the employee housing units. Please refer to the landscape plan included as an Exhibit to this Application. Wastewater Management and System Plan - 4-203.N The following information on Wastewater is from the Engineering Report completed by Sopris Engineering included as an Exhibit to this Application. SE will prepare an OWTS plan that will delineate existing and proposed conditions, proposed OWTS components, design calculations, and grading for the System in accordance with the Garfield County Regulation 43. The OWTS will be designed based on design flow capacity, soil conditions, setbacks and site limitations. The system components and treatment technologies will be designed in compliance with current regulations. A preliminary pre application submittal process, that may include discussions with the County Environmental Health Department and Community Development, will be completed prior to submittal of the OWTS Permit application package. The site development plan includes a small single-family residence centrally located on the parcel between the east and west mini storage complexes. The proposed 3-bedroom modular house will have a detached garage. Based on our review of the existing/proposed site conditions and aerial mapping, a suitable area for conventional OWTS field components is available across the proposed driveway just west of the proposed residential structure. It appears that soils, grading elevations and design flow usage will allow for a conventional gravity system design with absorption/treatment fields, based on the existing soil conditions. The OWTS will consist of a two-compartment concrete septic tank, a STU utilizing chamber trenches in native soils and gravity distribution via a distribution box. Division 1. General Approval Standards 7-101. Zone District Use Regulations The 38 acre property is zoned Rural and requires a Land Use Change Permit via Limited Impact Review for the proposed self storage use. The proposed use will comply with the 40’ non-residential height limit, the 10’ side yard setback, the 25’ front yard setback, the 50’ Highway setback, and the 100’ setback from residential property lines. There will be two outdoor storage areas that will comply with a 100’ setback from all property lines. There is not a non-residential lot coverage maximum in the Rural Zone District. Royal Mini Storage West Glenwood Limited Impact Review Application 23 23 7-102. Comprehensive Plan and Intergovernmental Agreements A. Consistency with Garfield County Comprehensive Plan The proposed mini storage facility is consistent with the Garfield County Comprehensive plan, which incorporates the Glenwood Springs comprehensive plan because the site is located within the City’s Urban Growth Boundary and will supply needed storage for the high density residential projects recently proposed within the Urban Growth Boundary. B. Consistency with Glenwood Springs Comprehensive Plan The City of Glenwood Springs Comprehensive Plan defines the Urban Growth Boundary as an area that can support urban-level development. Future land use objectives as defined in the City’s Comprehensive Plan designate this parcel as Residential Low density. Although this parcel can support urban-level development in the form of a mini storage facility, it is not an appropriate use for housing or urban level residential density due to emergency access restrictions. The proposal of a storage facility will generate very low traffic in and out of the site and require minimal utility services while providing housing support in the form of self storage for the nearby residential neighborhoods. 7-103. Compatibility The proposed Self Storage Facility is located in an area that will benefit from a low traffic volume use such as mini storage. This low traffic use will also minimally impact adjoining property owners. With an increased number of rental units constructed in Glenwood Springs there will be a need for individual mini storage units available for rent. This west Glenwood Springs location is easily accessible from 1-70 and from the City of Glenwood Springs to serve clients on the eastern side of Garfield County. 7-104. Source of Water A letter addressing Legal Water Supply for the MMME WG property has been provided by Michael Sawyer of Karp Neu Hanlon, P.C. It has been included as an Exhibit to this Application. Also see section 4-203.M 7-105. Central Water Distribution and Wastewater Systems See section 4-203.N Royal Mini Storage West Glenwood Limited Impact Review Application 24 24 7-106. Public Utilities Sopris Engineering has provided an Engineering Report and a Conceptual Utility Plan that are both included as Exhibits to this Application. 7-107. Access and Roadways A Traffic Summary has been completed by Sopris Engineering and is included as an Exhibit to this Application. The proposed development is to be accessed from the CDOT right-of-way of Highway 6 & 24. Since the access is within the CDOT right-of-way an Access Permit has been acquired from the state and is attached to Engineering Report. Both the county and state standards for the access are being met with the proposed design. 7-108. Use of Land Subject to Natural Hazards A Rockfall Evaluation has been completed for the subject property however current development of the site proposes no new structures in the rockfall area. The property does contain some slopes of greater than 30% but the proposed site development avoids construction in areas with slopes greater than 20% The property has experienced debris flow events in the past. A Mudflow report is included as part of the Sopris Engineering Report included as an Exhibit to this Application. 7-109. Fire Protection The Applicant met with Greg Bak of the Glenwood Springs Rural Fire Protection District on January 10, 2022, to review emergency vehicle ingress/egress as well as fire protection requirements. Based on this input the Applicant agrees to maintain a 20’ vegetation free rip-rap or cobble perimeter around the storage facility to help minimize any potential impacts from wildfire. See the Sopris Engineering’s report included as an Exhibit to this Application for details related to Fire Protection and Emergency Access. Division 2. General Resource Protection Standards. 7-201. Agricultural Lands No agricultural operation currently exist on the proposed development parcel and no other agricultural operations will be negatively impacted by the proposed Storage Facility. Royal Mini Storage West Glenwood Limited Impact Review Application 25 25 7-202. Wildlife Habitat Areas A Wildlife Impact Report was completed on April 4, 2022 by Eric Petterson, Senior Ecologist with SGM. The Summary of Findings states there are no Threatened or Endangered Species issues associated with the site. The full report has been included as an Exhibit to this Application 7-203. Protection of Waterbodies No waterbodies exist on the proposed development parcel and no nearby waterbodies will be negatively impacted by the proposed Storage Facility. 7-204. Drainage and Erosion A Conceptual Site and Drainage Plan has been prepared by Sopris Engineering and is included as an Exhibit to this Application. Drainage and erosion control has also been addressed in an Engineering Report prepared by Sopris Engineering, which is included as an Exhibit to this Application. 7-205. Environmental Quality No outside processing of materials will occur on site. Vehicle trips for the proposed storage facility will be minimal and the parking area will paved to eliminate dust. No hazardous materials will be used or discharged into water from the proposed use. Wastewater management has been addressed in section 4-203.N below. 7-206. Wildfire Hazards The Applicant agrees to maintain vegetation control on the property to minimize any potential impacts from wildfire following State Forest Service guidelines for defensible space. Based on this input from Greg Bak with the Glenwood Springs Rural Fire Protection District the Applicant agrees to maintain a 20’ vegetation free rip-rap or cobble perimeter around the storage facility to help minimize any potential impacts from wildfire. 7-207. Natural and Geologic Hazards A Rockfall Hazard has been identified on the western end of the parcel Royal Mini Storage West Glenwood Limited Impact Review Application 26 26 as part of the Rockfall Evaluation and Mitigation Study prepared by RJ Engineering & Consulting, Inc. The study along with proposed mitigation options has been included as an Exhibit to this Application. A Mudflow Analysis has also been completed by Tetra Tech for this project and has been included as an Exhibit to this Application. 7-208. Reclamation See the Conceptual Site and Drainage Plan and the Landscape Plan included as an Exhibit to this Application. Division 3. Site Planning and Development Standards 7-301. Compatible Design The proposed Self Storage Facility is located in an area that will benefit from a low traffic volume use such as mini storage. This low traffic use will also minimally impact adjoining property owners. With an increased number of rental units constructed in Glenwood Springs there will be a need for individual mini storage units available for rent. This west Glenwood Springs location is easily accessible from 1-70 and from the City of Glenwood Springs to serve clients on the eastern side of Garfield County. 7-302. Off-Street Parking and Loading Standards See the Overall Site Plan sheet C-2.0 provided by Sopris Engineering for parking layout and design. Customers will be allowed to park for loading and unloading in front of each unit. An additional 4 parking spaces have been provided near the entry gate and office area. 7-303. Landscaping Standards A Landscape Plan has been submitted as an Exhibit to this Application. 7-304. Lighting Standards The Applicant agrees to the exterior lighting standards as required by the Garfield County Land use Code. See the Lighting Plan included as an Exhibit to this Application. 7-305. Snow Storage Standards Royal Mini Storage West Glenwood Limited Impact Review Application 27 27 The Applicant has areas sufficient to store snow without impacting off-street parking or public roadways. 7-306. Trail and Walkway Standards No recreational or community facilities are applicable with this Application. Division 10. Additional Standards for Industrial Uses 7-1001. Industrial Use Standards A. Residential Subdivisions This Application is not on property platted as a residential Subdivision. B. Setbacks The proposed storage facility has a 100’ setback from the nearest residential property line, a 50’ setback from I-70, and an 80’ setback from the side property lines. C. Concealing and Screening The storage facility will be a series of single story drive-up self storage units. The facility will be fenced and gated. An outdoor storage area will be provided as part of the proposed storage facility and will be surrounded with an 8’screened fence. D. Storing No hazardous products will be stored on this property. E. Industrial Wastes No flammable or explosive solids or gases and hazardous materials will be stored at this property. F. Noise Noise levels will not exceed State noise standards, no heavy equipment or machinery will be in use for this proposed use. G. Ground Vibration The Applicant agrees to the limits of ground vibration at any point of any boundary line of the property. No ground vibration will occur from this storage facility use. H. Hours of Operation Mini Storage access hours are 6:00 a.m. to 10:00 p.m. daily. I. Interference, Nuisance, or Hazard Royal Mini Storage West Glenwood Limited Impact Review Application 28 28 The Applicant does not propose any use of items that will create glare, flaring of gases, reflective materials or other legal requirements for safety Site lighting will be at the front entry and downlights at the bay doors. See the lighting plan included as an Exhibit to this Application. Exhibits: Title Commitment Engineering Report, Sopris Engineering Civil Plan Set, Sopris Engineering Subsoil Study, Kumar & Associates, Inc Rockfall Evaluation and Mitigation Study, RJ Engineering Mudflow Analysis, Tetra Tech NWP-39, U.S. Army Corps Application and Consultation, SME Environmental Wildlife Impact Report ALTA/NSPS Land Title Survey Legal Water Supply Letter Landscape Plan, The Land Studio, Inc. Lighting Plan, RAB Lighting Title Commitment Commonwealth Title Company of Garfield County, Inc. 127 E. 5th Street Rifle, CO 81650 Phone (970) 625-3300 / Fax (970) 625-3305 1322 Grand Avenue Glenwood Springs, CO 81601 Phone (970) 945-4444 / Fax (970) 945-4449 Date: March 17, 2022 File No. 1906063.1 Property Address. 49893 Highway 6 & 24, Glenwood Springs MMME WG, LLC Email: mark@gouldconstruction.com COMMITMENT FOR TITLE INSURANCE SCHEDULE A File No. 1906063.1 1. Effective Date: March 11, 2022 at 7:59 AM 2. Policy or Policies to be issued: (a) ALTA OWNER POLICY (ALTA 6-17-06) $N/A Proposed Insured: (b) ALTA LOAN POLICY (ALTA 6-17-06) Proposed Insured: 3. The Estate or interest in the land described or referred to in the Commitment and covered herein is Fee Simple and is at the effective date hereof vested in: MMME WG, LLC, a Colorado limited liability company 4. The land referred to in this Commitment is situated in the County of Garfield, State of Colorado and described as follows: See Attached Exhibit "A" TITLE CHARGES Title Commitment Update $167.00 COUNTERSIGNED: ___________________Patrick P. Burwell_____________________________ Authorized Officer or Agent Valid Only if Schedule B and Cover Are Attached American Land Title Association Issuing Agent: Schedule A Commonwealth Title Company of Garfield County, Inc. (Rev'd 6-06) 127 East 5th Street Rifle, CO 81650 File No. 1906063.1 EXHIBIT "A" A parcel of land situated in S1/2NE1/4 and in Lot 1 of Section 1, Township 6 South, Range 90 West of the 6th Principal Meridian, Garfield County, Colorado, lying Northerly of the Northerly right-of-way line of Interstate-70, and being more particularly described as follows: Beginning at a point on the Easterly boundary line of said Section 1 whence and aluminum cap found in place and properly marked for the Northeast Corner of said Section 1 bears North 00°15'14" West 350.00 feet; thence South 00°15'14" East 1106.70 feet along the Easterly boundary line of said Section 1 to a point on the Northerly right-of-way line of said Interstate-70; thence along said Northerly right-of-way line on the following three (3) courses; 466.93 feet along the arc of a 5328.70 foot radius curve to the left, the chord of which bears North 87°56'53" West 466.79 feet; thence South 00°27'30" East 20.00 feet; thence 785.17 feet along the arc of a 5308.70 foot radius curve to the left, the chord of which bears South 85°18'16" West 784.46 feet; thence leaving said Interstate right-of-way line on a course bearing North 239.81 feet; thence East 103.82 feet; thence North 46°28'29" East 195.90 feet; thence North 71°00'00" East 143.51 feet; thence North 739.78 feet; thence North 89°08'18" East 861.79 feet to the point of beginning, Also Known as: Parcel A, amended Dever Subdivision Exemption recorded November 21, 1994 as Reception No. 501339 A parcel of land situated in S1/2NE1/4 and in Lot 1 of Section 1, Township 6 South, Range 90 West of the 6th Principal Meridian, Garfield County, Colorado, lying Northerly of the Northerly right-of-way line of Interstate-70, and being more particularly described as follows: Beginning at a point whence an aluminum cap found in place and properly marked for the Southwest Corner of Lot 1 of said Section 1 bears North 00°22'23" East 50.00 feet; thence East 88.00 feet; thence South 00°22'23" West 239.81 feet to a point on the Northerly right-of-way line of said Interstate-70; thence along said Northerly right-of-way line on the following two (2) courses; 1457.68 feet along the arc of a 5308.70 foot radius curve to the left, the chord of which bears South 73°12'04" West 1453.10 feet; thence North 24°39'54" West 100.00 feet to a point on the North-South centerline of said Section 1; thence North 00°59'55" East 582.39 feet along said North-South centerline; thence North 89°04'23" East 1285.08 feet; thence South 00°22'23" West 34.19 feet; thence East 50.00 feet to the point of beginning, Also Known as: Parcel B Amended Dever Subdivision Exemption recorded November 21, 1994 as Reception No. 501339. File No. 1906063.1 SCHEDULE B - SECTION 1 The Following are the requirements to be complied with prior to the issuance of said policy or policies. Any other instrument recorded subsequent to the date hereof may appear as an exception under Schedule B of the policy to be issued. Unless otherwise noted, all documents must be recorded to the office of the Clerk and Recorder of the County in which said property is located. 1. The Proposed Insured must notify the Company in writing of the name of any party not referred to in this Commitment who will obtain an interest in the Land or who will make a loan on the Land. The Company may then make additional Requirements or Exceptions. 2. Pay the agreed amount for the estate or interest to be insured. 3. Pay the premiums, fees, and charges for the Policy to the Company. NM 6 American Land Title Association Commitment Schedule B - Section 1 - Form 1004-5 DISCLOSURES Colorado Division of Insurance Regulation 8-1-2, Section 5, Paragraph F provides: "Whenever a title entity provides the closing and settlement service that is in conjunction with the issuance of an owner's policy of title insurance, it shall update the title commitment from the date of issuance to be as reasonably close to the time of closing as permitted by the real estate records. Such update shall include all impairments of record at the time of closing or as close thereto as permitted by the real estate records. The title insurance company shall be responsible to the proposed insured(s) subject to the terms and conditions of the title commitment, other than the effective date of the title commitment, for all undisclosed matters that appear of record prior to the time of closing." Provided Commonwealth Title Insurance Company of Garfield County, Inc. conducts the closing of the insured transaction and is responsible for recording the legal documents from the transaction, exception number 5 will not appear on the Owner's Title Policy and the Lenders Policy when issued. This Notice is required by Colorado Division of Insurance Regulation 8-1-2, Section 5, Paragraph G. Pursuant to Colorado Division of Insurance Regulation 8-1-2, notice is hereby given that affirmative mechanic's lien protection for the prospective insured owner may be available upon compliance with the following conditions: A. The land described in Schedule A of this Commitment must be a single family residence, which includes a condominium or townhouse unit. B. No labor or materials may have been furnished by mechanics or materialmen for purposes of construction on the land described in Schedule A of this Commitment within the past 6 months. C. The Company must receive appropriate affidavits indemnifying the Company against all unfiled mechanic's and materialmen's liens. D. Any deviation from conditions A through C above is subject to such additional requirements or information as the Company may deem necessary; or, at its option, the Company may refuse to delete the exception. No coverage will be given under any circumstances for labor or material for which the insured has contracted for or agreed to pay. Colorado Division of Insurance Regulation 8-1-2, Section 5, Paragraph M. Pursuant to Colorado Division of Insurance Regulation 8-1-3, notice is hereby given of the availability of a Closing Protection Letter which may, upon request, be provided to certain parties to the transaction. Pursuant to C.R.S. §10-11-122, notice is hereby given that: A) The subject real property may be located in a special taxing district; B) A Certificate of Taxes Due listing each taxing jurisdiction may be obtained from the County Treasurer's authorized agent; C) The information regarding special districts and the boundaries of such districts may be obtained from the Board of County Commissioners, the County Clerk and Recorder, or the County Assessor; and D) The company will not issue its policy of policies of title insurance contemplated by the commitment until it has been provided a Certificate of Taxes due from the County Treasurer or the County Treasurer's authorized agent; or until the Proposed Insured has notified or instructed the company in writing to the contrary C.R.S. §30-10-406 requires that all documents received for recording or filing in the clerk and recorder's office shall contain a top margin of at least one inch and a left, right, and bottom margin of at least one half of an inch. The clerk and recorder may refuse to record or file any document that does not conform. Pursuant to C.R.S. §10-11-123, notice is hereby given: This notice applies to owner's policy commitments containing a mineral severance instrument exception, or exceptions, in Schedule B, Section 2. A) That there is recorded evidence that a mineral estate has been severed, leased, or otherwise conveyed from the surface estate and that there is a substantial likelihood that a third party holds some or all interest in oil, gas, other minerals, or geothermal energy in the property; and B) That such mineral estate may include the right to enter and use the property without the surface owner's permission. If the transaction includes a sale of the property and the price exceeds $100,000.00, the seller must comply with the disclosure/withholding provisions of C.R.S. §39-22-604.5 (Nonresident withholding). Pursuant to C.R.S. §38-35-125(2), no person or entity that provides closing and settlement services for a real estate transaction shall disburse funds as a part of such services until those funds have been received and are available for immediate withdrawal as a matter of right. Colorado Division of Insurance Regulation 8-1-2, Section 5, Paragraph J. "Good Funds Law" C.R.S. §39-14-102 requires that a real property transfer declaration accompany any conveyance document presented for recordation in the State of Colorado. Said declaration shall be completed and signed by either the grantor or grantee and Section 38-35-109 (2) of the Colorado Revised Statutes, 1973, requires that a notation of the purchasers legal address, (not necessarily the same as the property address) be included on the face of the deed to be recorded. File No. 1906063.1 SCHEDULE B - SECTION 2 Schedule B of the Policy or Policies to be issued will contain exceptions to the following matters unless the same are disposed of to the satisfaction of the company: 1. Rights or claims of parties in possession not shown by the Public records. 2. Easements, or claims of easements, not shown by the public records. 3. Discrepancies, conflicts in boundary lines, shortage in area, encroachments, and any facts, which a correct survey and inspection of the premises would disclose, and which are not shown by the public records. 4. Any lien, or right to a lien, for services, labor or material heretofore or hereafter furnished, imposed by law and not shown by the public records. 5. Defects, liens, encumbrances, adverse claims or other matters, if any, created, first appearing in the public records or attaching subsequent to the effective date hereof but prior to the date the proposed insured acquires of record for value the estate or interest or mortgage thereon covered by this commitment. 6. Any and all unpaid taxes, assessments and unredeemed tax sales. 7. Any lien or charge on account of the inclusion of subject property in an improvement district. 8. Any and all water rights, claims, or title to water, whether or not the matters excepted are shown by the public record. 9. Right of the proprietor of a vein or lode to extract and remove his ore therefrom, should the same be found to penetrate or intersect the premises hereby granted and a right of way for ditches or canals as constructed by the authority of the United States, as reserved in United States Patent recorded October 20, 1924 in Book 88964 and August 18, 1905 as Reception No. 30984 at Page . 10. Reservation by the United States, Its Permitee or Licensee the right to enter upon, occupy and use any part of all of said Lot 1 of Section 1 for the purposes provided in the act of June 10, 1920 (41 stat 1063) and subject to the conditions and limitations of Section 24 of said act as contained in Patent recorded October 20, 1924 as Reception No. 88964. 11. Right of way for ditches and canals in place an in use. 12. Right of way granted to the Mountian States Telephone and Telegraph Company in instrument recorded September 27, 1911 as Reception No. 42677. 13. Easements and rights of way contained in instrument recorded June 11, 1928 as Reception No. 101702. 14. Easements and rights of way for stock Driveway contained in instruments recorded December 29, 1943 as Reception No. 150685 and December 30, 1943 as Reception No. 150690. 15. Each and every right of access contained in instrument recorded June 7, 1967 as Reception No. 238095. 16. Right-of-way Easement granted to The Mountain States Telephone and Telegraph Company in instrument recorded April 5, 1968 as Reception No. 240548. 17. Garfield County Resolution No. 81-386 recorded December 22, 1981 as Reception No. 322945. 18. Right of way for ingress and egress and right of way for a pipeline from the Dever Well No. 2 contained in instrument recorded October 20, 1992 as Reception No. 440192. 19. Garfield County Resolution No. 95-015 recorded March 7, 1995 as Reception No. 475248. 20. Easements contained in instruments recorded June 12, 1981 in Book 574 at Page 317, and April 14, 1995 in Book 937 at Page 413. 21. Terms and conditions of Easement Agreement recorded September 29, 2000 as Reception No. 570056. (Continued) File No. 1906063.1 SCHEDULE B - SECTION 2 (Continued) 22. Easements, rights of way and all other matters shown on the Dever Subdivision Exemption Plat recorded February 14, 1995 as Reception No. 474423 and the amended Dever Subdivision Exemption Plat recorded November 21, 1996 as Reception No. 501339. 23. Possessory rights outside of fence, apparent easement for overhead utilities and all matters shown on ALTA/NSPS Land Title Survey dated July 27, 2019, Job No. S2S19-100. 24. Reservation of all oil, gas and other minerals as described in Special Warranty Deed recorded September 17, 2019 as Reception No.925532 and any and all assignments thereof or interests therein. 25. Defects, liens, encumbrances, adverse claims or other matters, if any, created, first appearing in the public records or attaching subsequent to the effective date hereof and the date on which all of the Schedule B, Part 1-Requirements are met. The Owner's Policy of Title Insurance committed for in this Commitment, if any, shall contain, in addition to the Items set forth in Schedule B - Section 2, the following items: (1) The Deed of Trust, if any, required under Schedule B - Section 1. (2) Unpatented mining claims; reservations or exceptions in patents or in Acts authorizing the issuance thereof. (3) any and all unpaid taxes, assessments and unredeemed tax sales. NOTE: The policy (s) of insurance may contain a clause permitting arbitration of claims at the request of either the Insured or the Company. Upon request, the Company will provide a copy of this clause and the accompanying arbitration rules prior to the closing of the transaction. American Land Title Association Commitment Schedule B - Section 2 Form 1004-12 COMMONWEALTH TITLE COMPANY PRIVACY POLICY We Are Committed to Safeguarding Customer Information In order to better serve your needs now and in the future, we may ask you to provide us with certain information. We understand that you may be concerned about what we will do with such information - particularly any personal or financial information. We agree that you have a right to know how we will utilize the personal information you provide to us. Therefore, we have adopted this Privacy Policy to govern the use and handling of your personal information. Applicability This Privacy Policy governs our use of the information which you provide to us. It does not govern the manner in which we may use information we have obtained from any other source, such as information obtained from a public record or from another person or entity. Types of Information Depending upon which of our services you are utilizing, the types of nonpublic personal information that we may collect include: •Information we receive from you on applications, forms and in other communications to us, whether in writing, in person, by telephone or any other means. •Information about your transactions with us, our affiliated companies, or others; and •Information we receive from a consumer reporting agency. Use of Information We request information from you for our own legitimate business purposes and not for the benefit of any nonaffiliated party. Therefore, we will not release your information to nonaffiliated parties except: (1) as necessary for us to provide the product or service you have requested of us; or (2) as permitted by law. We may, however, store such information indefinitely, including the period after which any customer relationship has ceased. Such information may be used for any internal purpose, such as quality control efforts or customer analysis. We may also provide all of the types of nonpublic personal information listed above to one or more of our affiliated companies. Such affiliated companies include financial service providers, such as title insurers, property and casualty insurers, and trust and investment advisory companies, or companies involved in real estate services, such as appraisal companies, home warranty companies, and escrow companies. Furthermore, we may also provide all the information we collect, as described above to companies that perform marketing services on our behalf, on behalf of our affiliated companies, or to other financial institutions with whom we or our affiliated companies have joint marketing agreements. Former Customers Even if you are no longer our customer, our Privacy Policy will continue to apply to you. Confidentiality and Security We will use our best efforts to ensure that no unauthorized parties have access to any of your information. We restrict access to nonpublic personal information about you to those individuals and entities who need to know that information to provide products or services to you. We will use our best efforts to train and oversee our employees and agents to ensure that your information will be handled responsibly and in accordance with this Privacy Policy. We currently maintain physical, electronic and procedural safeguards that comply with federal regulations to guard your nonpublic personal information. Engineering Report Sopris Engineering To: Doug Pratte 365 River Bend Way Glenwood Springs, CO 81601 Landstudio2@comcast.com RE: Engineering Report for Royal Mini Storage of West Glenwood at 49893 Highway 6&24, Glenwood Springs, Colorado SE Project #19137.01 Dear Mr. Pratte, April 21, 20221 Sopris Engineering, LLC (SE) has prepared the following Engineering Report to address the sewer, water, fire protection, access, and traffic impacts to the proposed mini storage facility development. The Royal Mini Storage facility will contain approximately 140,500 square feet of indoor storage, to be developed in three phases. Outdoor storage will also be provided as a part of the storage development. All proposed storage buildings will be one-story. In addition, to the mini storage facility, two employee housing units are proposed, each home to be approximately 1,500 square feet. The site is located near Storm King Mountain, North of Interstate 70, 1330 feet East of mile marker 113, and is situated in Garfield County, Colorado. The existing subject property serves one existing residential home. Access to another single-family home and to BLM land is granted through an easement on the subject property. Attached to this letter is the Civil plan set including existing condition, grading, site, and utility plans. 7-104 Source of Water The subject site currently has three domestic wells permitted through the site. The well permit numbers are 30751, 30752, 30753, and are labeled as Dever Well's 1 through 3 respectively. The wells are permitted to have a combined maximum allowed usage of 0.44cfs for domestic and irrigation. 0.22cfs for domestic usage and 0.22cfs for irrigation purposes. Currently one well is serving the existing home on parcel #219301100070. The other two wells are located on parcel #218301100069. The proposed mini storage development will utilize the existing wells located on parcel 21830110069. These two wells will be utilized to serve the proposed employee house unit and supply water to the fire suppression tank. The fire suppression tank will be approximately 185,000 gallons of water. The site is anticipated to have trees for screening, but no landscape ground cover within 30 feet of the structures, due to coordination with the fire department. The irrigation is expected to be no more than 5 acres to irrigate trees and landscaping around the employee housing units. Please refer to the landscape plan, by Land Studio for further detail. I 502 Main Street • Suite A3 • Carbondale, CO 81623 • (970) 704-0311 • Fax (970) 704-0313 SOPRIS ENGINEERING • LLC civil consultants 7-107 Wastewater SE#. 19137.01 04/21/2022 Page2 SE will prepare an OWTS plan that will delineate existing and proposed conditions, proposed OWTS components, design calculations, and grading for the System in accordance with the Garfield County OWTS Regulations adopted June of 2018. The OWTS will be designed based on design flow capacity, soil conditions, setbacks and site limitations. The system components and treatment technologies will be designed in compliance with current regulations. A preliminary pre application submittal process, that may include discussions with the County Environmental Health Department and Community Development, will be completed prior to submittal of the OWTS Permit application package. The site development plan includes a small single-family residence centrally located on the parcel between the east and west mini storage complexes. The proposed 3-bedroom modular house will have a detached garage. Based on our review of the existing/proposed site conditions and aerial mapping, a suitable area for conventional OWTS field components is available across the proposed driveway just west of the proposed residential structure. It appears that soils, grading elevations and design flow usage will allow for a conventional gravity system design with absorption/treatment fields, based on the existing soil conditions. The OWTS will consist of a two-compartment concrete septic tank, a STU utilizing chamber trenches in native soils and gravity distribution via a distribution box. Subsurface Conditions A site-specific subsurface soil evaluation will be performed by Sopris Engineering, in the vicinity of the proposed OWTS field, prior to BP/OWTS construction application and after initial mass grading on the site is completed. The soils will be evaluated by observation and sampling of two excavated profile pits for characterization by application of the USDA soil texture method test. The soils will be tested to determine the hydraulic loading rate for a probable absorptive soil treatment level 1 system in native soils. The onsite soils are expected to generally consist of loamy sand soil type 1, to sandy loam, soil type 2 based on recent geotechnical evaluations for the current development and previous evaluations for the existing residence on site. The soils below nil to 6 inches of topsoil are assumed to consist of medium dense sandy loam from 1.0 to 6 feet below the surface in the proposed area of the field. Therefore, the native soils to be sampled from 3 to 4 feet below the surface are expected to be characterized as a soil type 2 consisting of sandy loam texture of moderate coarse granular structure with scattered gravels and cobbles having a rock content less than 35%. A type 2 soil has an effective loading rate for conventional soil treatment of 0.6 Gal/S.F./day for a level 1 conventional treatment system. The equivalent percolation rate is 15-25 minutes per inch. No free water was encountered in excavations on site. Groundwater levels are expected to be below 20 feet from the existing surface grades. The soils below 6 to 7 feet are assumed to become rockier and may transition to be characterized as a USDA rocky soil Rl type 2 consisting of dense rocky sandy silt loam texture of granular structure with rock content exceeding 35% rock with gravel being less than 3/4 inch and containing less than 20% cobbles and small boulders in the sandy loam matrix. The equivalent percolation rate is 15-25 minutes per inch. No free water I 502 Main Street • Suite A3 • Carbondale, CO 81623 • (970) 704-0311 • Fax (970) 704-0313 SOPRIS ENGINEERING • LLC civil consultants SE#. 19137.01 04/21/2022 Page 3 was encountered in excavations on site. Groundwater levels are expected to be below 10 feet from the existing surface grades. A subsoil study was conducted on July 26 and 29, 2019 by Kumar & Associates, Inc. that included three exploratory borings drilled at select locations on the site with variable soil and rock content consisting of Silty sand with gravel and very silty sand with gravels expected to be characterizes as loamy sand soil type 1, to sandy loam, soil type 2 for the determination of appropriate LT AR loading rates. A subsurface Investigation for an OWTS was performed by All Service Septic in 2009 for the existing 2-bedroom residence on site that is located approximately 500 feet up slope from the proposed new Residence. The soils encountered at the time that were reported to consist of clayey sand with scattered rock to the profile pit depth of 7-feet. Percolation testing resulted in rates ranging from 10 to 14 minutes per inch. The equivalent USDA soil classification would be a loamy sand soil type 1. The design capacity for the system was based on 450gpd for a 3-bedroom residence. The system consists of a 1,000 gallon two-compartment tank followed by 3 gravel-less trenches providing 396 S.F. of infiltrative area. Conceptual Design Recommendations Proposed single family Residence: Based on soil conditions and to provide an efficient Treatment level 1 soil treatment unit a simple gravity trench system with distribution box is recommended for this application. A two-compartment concrete septic tank is adequate for the design flow of 450 gpd for the small 3-bedroom modular residential structure proposed. The conceptual system design complies with the current County Regulations with sizing calculations based on the long -term acceptance rate (LT AR) of gallons per square foot per day for a type 2 soil, treatment level-1 soil treatment unit (STU). The STU field will consist of a total 525 S.F. treatment/absorption field area. The system includes 4 shallow gravity chamber trenches set at variable elevations. The effluent will be equally distributed to the trenches through individual distribution pipes via a distribution box. Additional soil evaluations will be performed prior to building permit to verify the soils in the proposed field area to confirm loading rates and provide component installation recommendations for final OWTS design and permit application approval. The final design will be submitted for an OWTS construction permit with detailed plans, specifications, component details and design report. The preliminary design plan is attached. Existing Single-family residence: We understand that the existing single family ranch style modular home located in the westerly portion of the site is being replaced with a similar 3-bedroom modular structure in a slightly relocated position to the east of the current location. It is desired to maintain the existing OWTS for continued use to serve the rebuild structure. The existing system is approximately 11 years old and is expected to be adequate for continued usage as the same 3-bedroom equivalent capacity. The existing system consist of a two- compartment concrete septic tank with sanitary tees and effluent filter with effluent distribution to three trenches in series, consisting of 33 Infiltrator Quick-4 chambers in 3 trenches with 11 chambers per row. Each quick-4 chamber provides for 12 S.F. of infiltrative area per chamber. Therefore, the existing 33 chambers provide a total of 396 S.F. of STU absorption area. The design was based on an average percolation rate of 13 I 502 Main Street • Suite A3 • Carbondale, CO 81623 • (970) 704-0311 • Fax (970) 704-0313 SOPRIS ENGINEERING • LLC civil consultants SE#. 19137.01 04/21/2022 Page4 mpi. Assuming a soil type 1, loamy sand with a treatment level 1 LT AR of 0.8 gal/SF/day, the required area for the STU per current regulation would be 394 S.F. The existing system sizing per current regulations is as follows utilizing the allowable area reduction of 0.7 for chamber and the LTAR for loamy sand: 450 gpd x 0.7 / 0.8 gal/SF/day = 394 S.F. / 12 S.F./ Chamber= 33 chambers required. The existing system has adequate capacity for the replacement 3-bedroom modular residence. Public Utilities The existing subject property has over head power running through the property, and Glenwood Electric has agreed to serve the development, see attached Will Serve Letter. As for phone, cable, and gas all are available to be extend to the property. The additional Will Serve Letters are attached to this report from Black Hills Energy, Comcast, and CenturyLink. Power will be provided for the security gates to the storage units and to the proposed office building. Additional electrical service will be provided to the proposed employee housing unit. The existing home currently has electricity, a septic system, water from the existing well, and a propane tank for gas. Please refer to the civil utility plan sheet C4.0 for further detail. 7-107 Access and Roadways A. The proposed development is to be accessed from the CDOT right-of-way of Highway 6 & 24. Since the access is within the CDOT right-of-way an Access Permit has been acquired from the state and is attached to this letter. Both the county and state standards for the access are being met with the proposed design. B. The anticipated development of the site will allow for safe access to the site and will improve the current access to existing homes and proposed storage facility. Currently the access dead-ends and does not allow for safe and efficient maintenance of Highway 6 & 24. The proposed access improvements will allow for more efficient maintenance and access for state plows and emergency vehicles. C. Adequate capacity to the site will be provide by the anticipated traffic volumes. Since the site will be built in phases and full site development will not require large traffic volumes, the proposed road will be adequate. The anticipated volume of traffic will be low since people do not access their storage often. D. No right of ways will need to be dedicated because of this development. E. No impacts are associated with the mini storage. F. Design Standards and Traffic: The anticipated traffic impacts to the Highway 6 & 24 resulting from the residential development were estimated utilizing the Institute of Transportation Engineers (ITE) Trip Generation Manual, 9th Edition. The existing property access serves two single family homes, and the proposed access will serve the proposed three single-family home to the North of the property. The Trip Generation Manual is based on information submitted voluntarily to ITE by public agencies, developers, consulting firms and associations. It is a tool utilized by planners, transportation professionals, zoning boards, etc. to estimate vehicle trips generated by a proposed development. I 502 Main Street • Suite A3 • Carbondale, CO 81623 • (970) 704-0311 • Fax (970) 704-0313 SOPRIS ENGINEERING • LLC civil consultants SE#. 19137.01 04/21/2022 Page 5 The anticipated number of Peak Hour Vehicle Trips (PHV) and Average Daily Trips (ADT) for the proposed re-development are as follows: Existing AM Peak Hour Trips: ITE Code 210 (Single Family Detached Housing): A.M. Peak Hour: 0.77 vehicle trips per Single Family House=> (0.77) (2 Home)= 1.54 PHV (2) Existing PM Peak Hour Trips: ITE Code 210 (Single Family Detached Housing): P.M. Peak Hour: 1.02 vehicle trips per Single Family House=> (1.02) (2 Home)= 2.04 PHV (3) Proposed AM Peak Hour Trips: ITE Code 210 (Single Family Detached Housing): A.M. Peak Hour: 0.77 vehicle trips per Single Family House=> (0.77) (3 Home)= 2.31 PHV (3) ITE Code 151 (Mini-Warehouse): A.M. Peak Hour: 0.28 vehicle trips per 1,000 SF=> (0.28) (134,400 SF)= 39.17 PHV (40) Proposed PM Peak Hour Trips: ITE Code 210 (Single Family Detached Housing): P.M. Peak Hour: 1.02 vehicle trips per Single Family House=> (1.02) (3 Home)= 3.06 PHV (4) ITE Code 151 (Mini-Warehouse): P.M . Peak Hour: 0.29 vehicle trips per 1,000 SF=> (0.29) (134,400 SF)= 39.97 PHV (40) The existing AM and PM peak hour trips are 2 and 3 respectively. The proposed AM and PM peak hour trips are 43 and 44 trips respectively, resulting in a 41-trip increase in the morning and a 41-trip increase in the evening. The current access is categorized as a primitive driveway, using Table 7-107 Roadway Standards, at the dead-end of Highway 6&24. The anticipated traffic increase will change the design standards into the semi-primitive category. Both the county and state standards for the access are being met with the proposed design. I 502 Main Street • Suite A3 • Carbondale, CO 81623 • (970) 704-0311 • Fax (970) 704-0313 SOPRIS ENGINEERING • LLC civil consultants 7-109 Fire Protection and Emergency Access SE#. 19137.01 04/21/2022 Page6 All roads and accesses will be designed to allow for adequate access for all emergency and frre vehicles. SE has coordinated with the Fire Marshal about the proposed project improvements. He has required that the site have 20-30 of nominal rock ground cover placed around the structures for fire protection. From the landscape plan you can see no ground cover is being placed around the structures and trees have only been added for screening from Interstate-70. In addition, design of the subject property will provide accessibility to protect all the structures on site. With the proposed development an addition of a fire protection storage tank and hydrants are designed on site to provide protection to the proposed residential unit and storage facility. The storage tank will be placed north of the units in Phase 1 and 2. The tank is designed to hold approximately 185,000 gallons of water and will provide a minimum of 1,500 gallons per minute to each hydrant location. See Table 7-109 below for calculations on pipe diameter and flow rates to the highest elevation hydrant. The pipe diameter to allow for the minimum flow is proposed to be an 8" ductile iron pipe. Four hydrants will be placed through-out the development site, allowing for adequate accessibility to all structures on site. Please refer to the utility plan on Civil Sheet C4.0 Utility Plan, for an illustration of the fire suppression system. Table 7-109 GRAVITY MAIN I.D. C PEAK L PIPE HEAD STATIC HEAD MINOR HEAD TDH PRESSURE SIZE (in) (in) GPM (ft) LOSS(ft) (ft) LOSS(FT) (ft) PIPE(psi 12 12.00 130 1500 1510 8 .073 39 1 31 13 8 8.00 130 1500 1510 58.157 137 1 79 34 6 6.00 130 1500 1510 236.077 0 1 -237 -103 7-204 Drainage and Erosion Control The propose of a drainage study is to evaluate the existing and historical drainage conditions and estimate the flow rates at key design points to compare existing/historical versus post-development drainage conditions. While doing so calculations have been done to estimate the 25-year and 100-year post development peak runoff rates to support sizing of the stormwater mitigation infrastructure. Ensuring detention volumes are adequate for capacity of peak runoff rates for the 100-year storm event, required by Garfield County standards. In addition, Best Management Practice are recommended to minimize sediment transport offsite. The onsite soils consist of Type 'B, C, & D' Hydrologic Soils, according to the soil survey provided by the National Resource Conservation Service (NRCS). Based on our experience with soils in the town of Silt, we have assumed that overall, the site consists of Type 'C' soils, which have slow infiltration rates. Existing 0-ffsite & Onsite Drainage Basins The existing drainage conditions were analyzed to estimate historic and existing peak stormwater flow rates affecting the site and were based on site survey topography and site visits. Existing design points were also established at general discharge locations for comparison between historic and post development drainage conditions. The resultant basins and design point locations are described in greater detail below and are illustrated on civil sheet C6.0. I 502 Main Street • Suite A3 • Carbondale, CO 81623 • (970) 704-0311 • Fax (970) 704-0313 SOPRIS ENGINEERING • LLC civil consultants Offsite Drainage: SE#. 19137.01 04/21/2022 Page 7 The site has several offsite drainage basins north of the subject property parcels. It was determined by a consultant, Tetra tech, that there are 4 drainage basins that impact the subject site. As labeled on civil sheet C6.0 the drainage basins are as follows. Off site A: This drainages basin is along the Eastern boundary line of the subject property and the neighboring Ami's acres. Currently the offsite, debris/mudflow routes itself from down the neighboring and along the property line, to the drainage ditch north of highway 6 &24. It is our understanding that there is potential for the mudflow to over top a small berm created naturally at the north end of the subject property. To manage this potential risk SE has designed a drainage channel to reroute the mudflow away from the proposed storage units and protect the neighboring property. This proposed channel is 6 feet deep and 4 foot wide at the bottom. The channel will run from the north end of the property bound by the 30% slope line and end at the south boundary line. Allowing the flow to collect in the highway ditch as historical done. No detention is proposed for this off-site drainage. Offsite B: This drainage basin begins collect storm runoff at the peak of the mountain north of the subject property and runs down a dry creek bed. Once reaching the existing gravel road, the mud flow starts to disperse in more of a sheet flow then a concentrate path. To help mitigate this, SE has deepened the existing creek bed at the bottom of the existing channel. Tetra Tech provided SE with potential debris flow numbers, 0.5 acre-feet. With that area in mind SE provide a detention basin with 0.54 ac-ft of storage. In addition to these mitigation measures, a low point was graded into that basin to allow for any potential overflow to be routed to another basin to the south. This basin is between building Al and A4, sized at 0.319 ac-ft. Finally, any flow that would potential leave that basin will then go through a grate and 60" smoothed walled diameter pipe, to the existing outfall point south of highway 6 & 24. Offsite C: This offsite basin collects drainage from uphill of the site at a flow rate of approximately 32.4 cubic feet per second, resulting in 0.46 ac-ft of debris flow. To mitigate this debris flow on-site a basin has been designed between the buildings of phase 3, Cl and C4. The basin is sized to 0.619 ac-ft, providing 35% more storage than essentially required. If the basin is overtopped a drainage ditch is provided to a grate 60" smoothed wall pipe. This pipe is routed to an existing out fall point just north of interstate 70. Off site D: The last basin is located furthest West of the subject property between the existing home and the proposed storage units. The large channel has helped and failed to mitigate the debris flow from impacting 1-70 in the past. This large channel has been repeatedly filling with debris, thus limited the capacity over I 502 Main Street • Suite A3 • Carbondale, CO 81623 • (970) 704-0311 • Fax (970) 704-0313 I SOPRIS ENGINEERING • LLC civil consultants SE#. 19137.01 04/21/2022 Page 8 time. Tetra tech determined that the flow down this channel is 144 cfs and will require 2.57 ac-ft of storage. SE and Tetra Tech propose to dig out the existing channel of the historical sediment, providing 3.79 ac-ft of storage. Providing 47% more storage than required by calculations. The owner understands from historical events that the debris flow basins will have to be maintained on an annual basis or after a large event to maintain the required detention and protect the proposed structures. The resulting mitigation will not only protect the onsite, but potentially provide 1-70 from mudflow events like the one in July of 2019. Onsite Drainage: The site has been subdivided into four existing drainage basins. Existing basin EX-01 is located in phase 1 and 2 of the eastern portion of the site. The East limit of the basin is the property line between the subject property and Ami's Acres. The north boundary line for on-site drainage purposed is the 30% slope line. The area onsite included arid, desert like trees and shrubs. The stormwater runoff currently sheet flows from north to south, into the ditch running along Highway 6&24, which is identified on the plan as design point DP-1. Existing basin EX-02 is the eastern portion of phase 3. The north limit being the subject boundary line. The area consists of native trees and shrubs with limited ground cover. Stormwater runoff from this basin currently sheet flows north to south and makes it was to 1-70. There is one location that majority of the runoff collects though an existing culvert and this point is identified as design point DP-2 Existing basin EX-03 is the western portion of phase 3. This north limit being the subject boundary line and west limit being the existing drainage structure. The area consists of native trees and shrubs with limited ground cover. Stormwater runoff from this basin currently sheet flows north to south and makes it was to 1- 70. There is one location that majority of the runoff collects though an existing culvert and this point is identified as design point DP-3. Existing basin EX-04 is the most western portion of the site. This north limit being the subject boundary line and west limit being the 30% slope line to the west being Storm King Mountain. The area consists of native trees and shrubs with limited ground cover. The existing structure is in this basin. Stormwater runoff from this basin currently sheet flows north to south and makes it was to 1-70. There is one location that majority of the runoff collects though an existing culvert and this point is identified as design point DP-3. For the purposes of the drainage calculations, the onsite areas are assumed to be historic, undeveloped land. The offsite areas north of the subject property are considered with the modeling by Tetra-Tech. Drainage design and mitigation was coordinated with them to minimize impacts to the site and surrounding areas. For the onsite pre-post calculations, to design the storm water runoff those off site number were not accounted for in our calculations. The pre-post detention however was calculated assuming the entire area was undeveloped and mitigation measures were taken for both on and off site. The existing drainage basin delineations were used to estimate peak runoff rates for the subject property to determine allowable release rates for the developed site. The hydrologic methods, assumptions and results are summarized below. I 502 Main Street • Suite A3 • Carbondale, CO 81623 • (970) 704-0311 • Fax (970) 704-0313 SOPRIS ENGINEERING • LLC civil consultants Developed Onsite Drainage Basins SE#. 19137.01 04/21/2022 Page9 To properly size the proposed storm water mitigation infrastructure phases 1, 2, and 3 the overall basin limits remain unchanged. Developed Basin 1 (DE-1) This basin is the same as EXl. The proposed development will build out in two phases resulting in 48% impervious area. The roof drainage and pavement runoff will be routed to valley pans at the center of the buildings. Inlets will be place down the valley pans to collect the runoff into a 12" HOPE pipe. From there the pipe will go to a detention pond the East site of the Phase 2 buildings. This detention pond is sized to detain the runoff then, route it to the south at DP 1, at historical rates. Developed Basin 2 (DE-2) is the same as EX2 and will be developed with storage units and concrete pavement. The concept is the same as DE-1 roof and pavement runoff will be collected then routed in a 12" HOPE pipe to detention channel designed for OC. The proposed development in this basin is 50% impervious. Developed Basin 3 (DE-3) is the same as EX3 and will be built out as a part of phase 3. Again, the same concept is proposed, to collect the runoff via valley pans, inlets, and a 12" HOPE pipe. The drainage will then be routed OD basin area. The resulting impervious area is 44%. Developed Basin 4 (DE-3) is the same as EX4 and is currently under development. The existing home is being replaced in kind, and the outdoor storage area is already partially graded. The proposed impervious area is 30%. The drainage will sheet flow like the historical drainage and will be collected in a drainage ditch south of the access road. The methodology for estimating post development peak runoff rates for the 2-year, 25-year, and JOO-year storm events are discussed below and the results are summarized within Table 1. Hydrologic Analysis Methods & Assumptions Onsite and offsite drainage areas were analyzed using the Rational Method (Equation 1) since the cumulative total of tributary offsite basins and subject property being studied was less than 90 acres. Equation 1: Q = C* I* A Q = Runoff Flow Rate ( cfs ); C = Runoff Coefficient I = Rainfall Intensity (in/hr); A= Area of Basin (acres) The runoff coefficient (C) is a variable that represents the ratio of runoff to rainfall volumes during a storm event. The determination of C mainly depends on the soil type, watershed impervious and storm event frequency. Each drainage basin was studied to determine the percent of impervious area. Each basin's total or effective percent impervious area was used to establish a weighted runoff coefficient. The Mile High Flood District (MHFD), formerly the Urban Drainage Flood Control District (UDFCD) out of Denver, CO has developed runoff coefficient tables, which are based on the soil type, percent impervious, and the storm event. The C factor tables are included for reference in Appendix A of this report. I 502 Main Street • Suite A3 • Carbondale, CO 81623 • (970) 704-0311 • Fax (970) 704-0313 SOPRIS ENGINEERING • LLC civil consultants SE#. 19137.01 04/21/2022 Page 10 In addition to the C factor tables, the MHFD has a rational spreadsheet which allows a user to develop the site-specific C factors. SE has used the spreadsheet to determine the site specific weighted average runoff coefficients based on a Type C hydrologic soil classification. The spreadsheet is included in Appendix A. The design rainfall duration used in the Rational Method is referred to as the time of concentration. The time of concentration is the cumulative travel time, including overland flow and channelized flow, for runoff to get from the furthest point upstream of a basin to a designated design point. A minimum time of concentration (Tc) of 10 minutes was used for all basins. The site has been analyzed for the peak rainfall runoff for storm water system sizing and has been analyzed for the 1-hour storm event for detention/retention system sizing. A summary of the 25, and 100 year estimated peak runoff rates analyzed for this project are summarized in Table 1 below. Table 1: Existing and Post-Development Peak Runoff Summary DESIGN POINT SUMMARY -2 YEAR PEAK RUNOFF STORM DESIGN PT EXQi DEQ2 DET.PROV. DET.REQ. I.D. (cfs) (cfs) (cf) Q2 (cfs) DE-1 5.58 9.09 622 104 DE-2 1.19 2.12 200 28 DE-3 1.48 2.45 200 29 DE-4 2.20 2.39 130 6 I I I I DESIGN POINT SUMMARY -25 YEAR PEAK RUNOFF STORM DESIGN PT EXQ2s DEQis DET.PROV. DET.REQ. I.D. (cfs) (cfs) (cf) Q25 (cfs) DE-1 12.94 21.08 622 242 DE-2 2.76 4.92 200 64 DE-3 3.44 5.68 200 66 DE-4 5.10 5.54 130 13 I I I I DESIGN POINT SUMMARY -100 YEAR PEAK RUNOFF STORM DESIGN PT EXQ100 DEQ100 DET.PROV. DET.REQ. I.D. (cfs) (cfs) (cf) Ql00 (cfs) DE-1 17.05 27.78 622 731 DE-2 3.64 6.48 200 180 DE-3 4.54 7.48 200 198 DE-4 6.72 7.30 130 126 I 502 Main Street • Suite A3 • Carbondale, CO 81623 • (970) 704-0311 • Fax (970) 704-0313 SOPRIS ENGINEERING • LLC civil consultants I Storm Sewer Sizing SE#. 19137.01 04/21/2022 Page 11 Storm water runoff is routed on the surface via sheet flow to storm sewer inlets and is then routed in storm sewer pipes which daylight into site detention structures . The minimum main line storm sewer pipe onsite will be 12" ADS N-12 pipes with watertight joints. SE has provided general sizing parameters using the Manning's Equation (Equation 2). Equation 2: Q = 1.49/n * RW * A * sa.s Q = Runoff Flow Rate (cfs); n = Manning's Roughness Coefficient R = Hydraulic Radius (ft); A= Flow Area (sf), S = Channel Slope (ft/ft) The hydraulic capacity calculations have been separated by standard pipe sizes for site storm water drainage with a minimum 2% slope for pipes up to 12". Table 3 below summarizes the approximate 80% full pipe capacity. Supporting hydraulic data for all of the calculations has been provided within Appendix B Table 3: Hvdraulic Pipe capacitv Pipe Size (IN) Pipe Material Mannings n Slope 80% Full Capacity (CFS) 4 Solid PVC 0 .012 2.00% 0.27 6 Solid PVC 0 .012 2.00% 0.84 8 Solid PVC 0 .012 2.00% 1.81 12 ADS N12 0 .012 2.00% 5.33 Sediment and Eros ion Control Current construction standards provide parameters for mitigation of drainage and soil erosion activities relative to site development. Very limited storm water runoff from offsite affects this parcel and the site flows to existing low points. Standard best management practices (BMP' s) as described below shall be applied to this site. These BMP' s are primarily grouped for two stages of the development, the construction phase and the post development phase, with the main emphasis on soil erosion and sediment transport controls. Temporary Erosion Control during the construction phase for the proposed improvements there will be potential for soil erosion and offsite sediment transport triggered by surface runoff during rain events. The contractor must at a minimum install and maintain the following BMPs during the construction phase: ✓ An embedded silt fence around the disturbed soils and especially in the low receiving ends of the slopes. ✓ Prior to any clearing and grubbing, lot grading, and prior to any construction work, the contractor must construct temporary sediment basins in strategically located areas to collect runoff sediment and stop sediment from traveling offsite. ✓ The site must be inspected at the end of every 14-day period during construction, and silt deposits from behind the silt fencing and from the sediment pits must be removed regularly to ensure full functioning of this erosion control system. These activities must be always logged in a logbook available at the site for inspection. ✓ Vehicle tracking pads (mud racks) at the site entrance(s) must be installed to avoid mud tracking into public right of way . ✓ Seed & mulch must be placed over disturbed cut and fill slopes, and watered as necessary , to establish temporary vegetative ground cover until paving, gravel surface and/or landscaping is done. 502 Main Street • Suite A3 • Carbondale, CO 81623 • (970) 704-0311 • Fax (970) 704-0313 SOPRIS ENGINEERING • LLC civil consultants SE#. 19137.01 04/21/2022 Page 12 A construction site can be a very dynamic area; because of this the final location and selection of construction BMPs will be left up to the contractor. All appropriate permitting must be acquired prior to commencing construction and the criteria outlined within all appropriate permits must be adhered to until the associated permits have been closed. Permanent BMPs shall consist of a complete landscaping and ground covering task to permanently re- vegetate and cover bear grounds that will remain open space to avoid long-term soil erosion. This effort will reduce the risk of unnecessary degradation and failure of the drainage system. Temporary erosion control structures installed during construction shall be left in place as necessary and maintained until new vegetation has been reestablished at a 70% level. Upon reaching a satisfactory level of soil stabilization from the new vegetation, all erosion control structures shall be removed; except for the proposed sediment/retention basins. These should remain in place until they become a conflict with future improvements. The results of this drainage study describe improvements to the drainage patterns onsite and demonstrate that no adverse drainage impacts to the subject property or surrounding properties will result from the proposed development. 7-207 Natural Geological Hazards D. Rockfall: SE has coordinated with RJ Engineering and Consulting to the design of a wall to help protect the existing home that falls within the rockfall area. We propose a gabion wall placed at an angle approximately twenty feet from the existing home ranging from five to seven feet in height. Please refer to Civil Sheet C4.3 Grading Plan for a plan and profile of the gabion wall. Also attached to this report is the Rockfall Study completed by RJ Engineering & Consulting, on March 23 rd , 2022. There are no proposed structures within the rockfall zone. F. Slope Development: The proposed site development has been designed to avoid construction in areas with slopes greater than 30%. The site is not designed to have slopes greater than 20%, complying with the county standards for site construction. G. Development in Mudflow: The subject site as been plagued with debris flow events in the past and most recently in July of 2019 a mudslide from the subject property closed Interstate 70. SE worked with the mudflow consultant Tetra Tech to design a site that helps mitigate future debris flow and achieves the needs of the client. To accomplish such, Sopris and Tetra Tech worked hand in hand to design debris basins, channels and 60-inch culvert pipes to detain the mud and debris but allow the water pass on through the site. As you will be able to read in further detail in the Report completed by Tetra Tech on April 15 th , 2022, attached to this report. Beginning with the largest basin on site is far east of the subject property. The proposal is to clean out this basin from previous mud flow events and deepen the basin but keep the outer footprint intact. Then the existing 24" culvert will be upsized to a 60" culvert and daylight at the same historical point as before Although the pipe is being upsized the mud flow rates are being decreased by nearly 25,000 cubic feet in a 100-year storm event. As we move East through the site another debris flow runs through Phase 3 of the site and to help mitigate this, we have proposed a large sediment basin with again a 60" I 502 Main Street • Suite A3 • Carbondale, CO 81623 • (970) 704-0311 • Fax (970) 704-0313 SOPRIS ENGINEERING • LLC civil consultants SE#. 19137.01 04/21/2022 Page 13 culvert. The improvements in this area will decrease the volume of debris at the daylight point by 436 cubic feet in a 100-year event. The debris flow that impacts the subject property along phase 1 of the project have been mitigated by the design of two large basins. One being North of the BLM road and the other south of the BLM road just north of the proposed buildings. Once the northern basin is full it will drain through a 60-inch pipe into the southern basin, which again will outflow to the historic daylight point decreasing the sediment flow by approx. 10,500 cubic feet. Finally, we have the last potential debris flow area on the property line between the subject property and the neighboring Ami's Acres. This area a=has historically been an issue for Ami's Acres development. Sopris has proposed a wide channel running parallel to the property to collect any debris flow and route down to the drainage ditch along Highway 6 & 24 then across 1-70 to the Colorado river has historically been. The channel will consist of 50-foot benches to help slow the velocity of the debris flow. Further mitigation is being taken by implementing structures through out the channel to catch large debris like rocks, stick and trees. These mitigation measures will reduce the out flow of debris volume on Highway 6 and eventually 1-70 by approx. 7,000 cubic feet. It is our understand that the improvements of the subject property, through the mitigation of the debris flow will improve the current conditions of debris flow during large storm events and will also protect the structures on site. The over impacts leaving the site will be decrease by nearly 43,000 cubic feet. This could potential help prevent closures on I-70 like recent years. Please refer to Tetra Tech's report for further information on the debris flow analysis. Additional measures were also considered in the design for impacts to ephemeral streams. Under recent rulings with U.S Army Corps, as of September 9rd , 2021 stated that the Navigable Water Protection rule was remanded and vacated. This resulted in the site requiring ephemeral streams permit (NWP-39 Commercial Development) under the U.S. Army Corps and a formal consultation with the U.S. Fish and Wildlife Service (USFWS) on impacts to endangered species. Please refer to the NWP-39 application and the formal consultation completed by SME Environmental attached to this report for further detail. I 502 Main Street • Suite A3 • Carbondale, CO 81623 • (970) 704-0311 • Fax (970) 704-0313 SOPRIS ENGINEERING • LLC civil consultants Conclusion SE#. 19137.01 04/21/2022 Page 14 SE has reviewed the Garfield County's design standards as a process of designing the Royal Mini storage development. Taking into consideration the impacts of environmental hazards, community development, and site safety. It is our understand that the proposed storage unit development will adequately serve the site, meeting all the county requirements and the state standards required by CDOT. This development will not adversely affect the subject property, but ultimately improve the safety of the site, the impacted I-70 to the South and the neighboring property to the East. With the access improvements, mudflow and rockfall mitigation overall the site will greatly improve the safety of the existing structures on and off site. If you have any questions or need any additional information, please call. Sincerely, SOPRIS ENGINEERING, LLC Yancy Nichol, PE Principal Attachments: • Appendix A-Drainage Calculations • Appendix B-Will Serve Letters CDOT Access Permit • Civil Plan Set • Tetra Tech Mudflow Letter • RJ Engineering & Consulting Rockfall Study • Kumar & Associates Subsoil Study • Army Carp's NWP-39 Permit Application CC: Mark Gould Land Studio, Doug Pratte I 502 Main Street • Suite A3 • Carbondale, CO 81623 • (970) 704-0311 • Fax (970) 704-0313 SOPRIS ENGINEERING • LLC civil consultants Appendix A SE#. 19137.01 04/21/2022 Page 15 I 502 Main Street • Suite A3 • Carbondale, CO 81623 • (970) 704-0311 • Fax (970) 704-0313 SOPRIS ENGINEERING • LLC civil consultants >GY FOR APPLICATION OF RATIONAL METHOD GOULD STORAGE W. GLENWOOD 19137 Design Criteria : GARFIELD COUNTY 1/31/2022 : VARIOUS RETURN PERIODS 5yr 10yr 25yr 100yr in/hr in/hr in/hr 3.1 3.89 4 .74 6.52 2.27 2.85 3.62 4.77 hydro 1.84 2 .32 2 .94 3.88 hydro 0.70 0.85 1.06 1.65 hydro 0.41 0.48 0.59 0.74 hydro 0.07 0.08 0.09 0.11 hydro 0.81 1.18 1.49 1.56 2 .16 2 .74 OVERALL ONSITE Post-Development AREA AREA rational Surface AREA AREA AREA rational AC % coefficient Basin SF AC % coefficient 0.54 3 0.90 impv-pave 185148.1 4.25 24 0.90 0.04 0 0.90 impv-rool 159234 3 .66 21 0.90 13 .94 79 0.35 perv 424502.65 9 .75 55 0.35 17 .65 100 Total 768884 .75 17 .65 100 ,t Weighted Rational Coefficient AREA C PRODUCT SURFACE AREA C PRODUCT 0.54 0.90 0.48 PAVEMENT 4 .25 0.90 3 .83 0.04 0.90 0.04 METAL ROOF 3 .66 0.90 3 .29 13.94 0.35 4.88 NATIVE LAWN 9.75 0.35 3.41 17 .65 5.40 TOTAL 17 .65 10 .53 0.31 Cw 0.60 25-YEAR STORM C I lin/hrl Alacl Qlcfsl POST-DEVELOPMENT C I lin/hrl Alacl Qlcfsl 0.31 1.56 17 .65 8.42 O=CIA 0.60 1.56 17 .65 16.42 Tc= 10 MIN Tc= 10 MIN = (.5)Q(Tc+ 1.67Tc) = 112.41 els-min Vol = (.5)Q(Tc+ 1.67Tc) = 219.22 els-min " vor(60J: 6744.43 I Vol (cf)= Vo/(60)= 13153.08 Pre/Post runoff volume difference: 6408.64 25-YEAR STORM C I (in/hr) ACacl Q(cfsl POST-DEVELOPMENT C I (in/hr) ACacl Q(cfsl 0.31 3.62 17.65 19.54 O=CIA 0.60 3.62 17.65 38.10 Tc= 10 MIN Tc= 10 MIN = (.5)Q(Tc+ 1.67Tc) = 260.84 els-min Vol = (.5)Q(Tc+ 1.67Tc) = 508 . 70 els-min " vor(60J= 15650.54 I Vol (cf)= Vo/(60)= 30521 .88 Pre/Post runoff volume difference: 14871 .34 100-YEAR STORM C I Cin/hrl ACacl QCcfsl POST-DEVELOPMENT C I Cin/hrl ACacl QCcfsl 0.31 4 .77 17 .65 25.75 O=CIA 0.60 4 .77 17 .65 50 .21 Tc= 10 MIN Tc= 10 MIN = (.5)Q(Tc+ 1.67Tc) = 343.71 els-min Vol = (.5)Q(Tc+ 1.67Tc) = 670 .30 els-min " vor(60J= 20622.40 Vol (cf)= vor(60J= 60327.09 Pre/Post runoff volume difference: 39704.69 ---DESIGN FOR THIS STORM VOLUME SUMMARY V=C•I•r1•A mt=Cw 25-Year Return Freauencv Storm with 60 Minute duration CONDITION C I t I A = VIC.F.I Pre-Devi . 0.31 1.06 1.00 0.0833 768885 20760 r duration (in/hr) Post-Devi . 0.60 1.06 1.00 0.0833 768885 40486 DIFFERENCE: 19726 • I I OLOGY FOR APPLICATION OF RATIONAL METHOD ,TORAGE W. GLENWOOD 19137 Design Criteria: GARFIELD COUNTY 31/2022 FOR VARIOUS RETURN PERIODS 5yr 10yr 25yr 100yr 1r in/hr in/hr in/hr 2 3.1 3.89 4 .74 6.52 6 2.27 2.85 3.62 4.77 hydro 7 1.84 2.32 2.94 3.88 hydro 1 0.70 0.85 1.06+ 1.65 hydro 1 0.41 0.48 0.59 0.74 hydro 5 0.07 0.08 0.09 0.11 hydro 1 0.81 1.18 1.49 11 3 1.56 2.16 2.74 Basin 1A Post-Develo~ment :A AREA AREA rational Surface AREA AREA AREA rational AC % coefficient Basin SF AC % coefficient ,779 .50 0.45 5 0.90 impv-pave 95 ,699 2.20 23 0.90 0.00 0 0.90 impv-roof 102,280 2.35 25 0.90 393 ,999 9.04 95 0.35 ~erv 215 ,799 4.95 52 0.35 113 ,778 9.50 100 Total 413 ,778 9.50 100 icient Weighted Rational Coefficient AREA C PRODUCT SURFACE AREA C PRODUCT 0.45 0.90 0.41 PAVEMENT 2.20 0.90 1.98 0.00 0.90 0.00 METAL ROOF 2.35 0.90 2.11 9.04 0.35 3.17 NATIVE LAWN 4.95 0.35 1.73 9.50 3.57 TOTAL 9.50 5.82 0.38 Cw 0.61 2-YEAR STORM I C I Cin/hrl A(acl Q(cfsl POST-DEVELOPMENT C I Cin/hrl A(acl Q(cfsl 0.38 1.56 9.50 5.58 O=CIA 0.61 1.56 9.50 9.09 Tc= 10 MIN Tc= 10 MIN Vol= (.5)Q(Tc+1 .67Tc) = 74.44 cfs-min Vol= (.5)Q(Tc+1 .67Tc) = 121 .30 cfs-min of (cf)= Vo/*(60)= 4466.43 I Vol (cf)= Vo/(60)= 7277.94 Pre/Post runoff volume difference= 2811 .51 CF I 104 CY I 25-YEAR STORM I C I (in/hr) A(acl Q(cfsl POST-DEVELOPMENT C I (in/hr) A(acl Q(cfsl 0.38 3.62 9.50 12 .94 O=CIA 0.61 3.62 9.50 21 .08 Tc= 10 MIN Tc= 10 MIN Vol= (.5)Q(Tc+1 .67Tc) = 172.74 cfs-min Vol= (.5)Q(Tc+1 .67Tc) = 281 .48 cfs-min of (cf)= Vo/*(60)= 10364.41 I Vol (cf)= Vo/(60)= 16888.56 Pre/Post runoff volume difference= 6524.14 CF I 242 CY I 100-YEAR STORM I C I (in/hr) A(acl Q(cfsl POST-DEVELOPMENT C I (in/hr) A(acl Q(cfsl 0.38 4 .77 9.50 17.05 O=CIA 0.61 4 .77 9.50 27.78 Tc= 10 MIN Tc= 10 MIN Vol= (.5)Q(Tc+1 .67Tc) = 227.62 cfs-min Vol= (.5)Q(Tc+1 .67Tc) = 370 .90 cfs-min of (cf)= Vo/*(60)= 13656.97 Vol (cf)= Vo/*(60)= 33380.56 Pre/Post runoff volume difference= 19723.58 CF I 731 CY I OLOGY FOR APPLICATION OF RATIONAL METHOD ,TORAGE W. GLENWOOD 19137 Design Criteria : GARFIELD COUNTY 1/31/2022 FOR VARIOUS RETURN PERIODS ff 5yr 10yr 25yr 100yr 'hr in/hr in/hr in/hr 12 3.1 3.89 4 .74 6.52 56 2.27 2.85 3.62 4.77 27 1.84 2.32 2.94 3.88 51 0.70 0.85 1.06+ 1.65 31 0.41 0.48 0.59 0.74 )5 0.07 0.08 0.09 0.11 31 0.81 1.18 1.49 13 1.56 2.16 2.74 Basin 1B Post-Develo~ment EA AREA AREA rational Surface AREA AREA AREA rational F AC % coefficient Basin SF AC % coefficient 0.00 0 0.90 impv-pave 15,200 0.35 16 0.90 0.00 0 0.90 impv-rool 32 ,000 0.73 34 0.90 94,893 2.18 100 0.35 ~erv 47,693 1.09 50 0.35 94,893 2.18 100 Total 94,893 2.18 100 icient Weighted Rational Coefficient AREA C PRODUCT SURFACE AREA C PRODUCT 0.00 0.90 0.00 PAVEMENT 0.35 0.90 0.31 0.00 0.90 0.00 METAL ROOF 0.73 0.90 0.66 2.18 0.35 0.76 NATIVE LAWN 1.09 0.35 0.38 2.18 0.76 TOTAL 2.18 1.36 0.35 Cw 0.62 2-YEAR STORM I C I Cin/hrl Alacl Q(cfsl POST-DEVELOPMENT C I Cin/hrl A(acl Q(cfsl 0.35 1.56 2.18 1.19 O=CIA 0.62 1.56 2.18 2.12 Tc= 10 MIN Tc= 10 MIN Vol= (.5)Q(Tc+1.67Tc) = 15 .88 els-min Vol= (.5)Q(Tc+1 .67Tc) = 28 .29 els-min Vol (cf)= Vol*(60)= 952.73 I Vol (cf)= Vol(60)= 1697.42 Pre/Post runoff volume difference= 744.69 CF I 28CY I 25-YEAR STORM I C I (in/hr) A(acl Q(cfsl POST-DEVELOPMENT C I (in/hr) A(acl Q(cfsl 0.35 3.62 2.18 2.76 O=CIA 0.62 3.62 2.18 4 .92 Tc= 10 MIN Tc= 10 MIN Vol= (.5)Q(Tc+1.67Tc) = 36 .85 els-min Vol= (.5)Q(Tc+1 .67Tc) = 65 .65 els-min Vol (cf)= Vol*(60)= 2210.83 I Vol (cf)= Vol(60)= 3938.89 Pre/Post runoff volume difference= 1728.06 CF I 64CY I 100-YEAR STORM I C I (in/hr) A(acl Q(cfsl POST-DEVELOPMENT C I (in/hr) A(acl Q(cfsl 0.35 4 .77 2.18 3.64 O=CIA 0.62 4 .77 2.18 6.48 Tc= 10 MIN Tc= 10 MIN Vol= (.5)Q(Tc+1.67Tc) = 48 .55 els-min Vol= (.5)Q(Tc+1 .67Tc) = 86 .50 els-min Vol (cf)= Vol*(60)= 2913.17 Vol (cf)= Vol*(60)= 7785.29 Pre/Post runoff volume difference= 4872.12 CF I 180 CY I 'IOLOGY FOR APPLICATION OF RATIONAL METHOD GOULD STORAGE W . GLENWOOD 19137 Design Criteria : GARFIELD COUNTY 1/31/2022 • FOR VARIOUS RETURN PERIODS 2yr 5yr 10yr 25yr 100yr n/hr in /hr in /hr in /hr 1.12 3.1 3.89 4 .74 6.52 1.56 2.27 2.85 3.62 4.77 hydro 1.27 1.84 2.32 2.94 3.88 hydro ).51 0.70 0.85 1.06+ 1.65 hydro ).31 0.41 0.48 0.59 0.74 hydro ).05 O.D? 0.08 0.09 0.11 hydro ).61 0.81 1.18 1.49 1.13 1.56 2.16 2.74 Basin 1C Post-Development REA AREA AREA rational Surface AREA AREA AREA rational SF AC % coefficient Basin SF AC % coefficient 0.00 0 0.90 impv-pave 25,628 0.59 22 0.90 0.00 0 0.90 impv-rool 23,200 0.53 20 0.90 118,388 2.72 100 0.35 (:!erv 69,560 1.60 59 0.35 118,388 2.72 100 Total 118,388 2.72 100 ficient Weighted Rational Coefficient AREA C PRODUCT SURFACE AREA C PRODUCT 0.00 0.90 0.00 PAVEMENT 0.59 0.90 0.53 0.00 0.90 0.00 METAL ROOF 0.53 0.90 0.48 2.72 0.35 0.95 NATIVE LAWN 1.60 0.35 0.56 2.72 0.95 TOTAL 2.72 1.57 0.35 Cw 0.58 2-YEAR STORM I C I (in/hr) A(ac) Q(cfs) POST-DEVELOPMENT C I (in/hr) A(ac) Q(cfs) 0.35 1.56 2.72 1.48 O=CIA 0.58 1.56 2.72 2.45 Tc= 10 MIN Tc= 10 MIN Vol= (.5)Q(Tc+1 .67Tc) = 19.81 els-min Vol= (.5)Q(Tc+1.67Tc) = 32 .65 els-min Vol (cf)= Vol*(60)= 1188.62 Vol (cf)= Vol(60)= 1958.99 Pre/Post runoff volume difference= 770.37 CF 29 CY 25-YEAR STORM I C I (in/hr) A(acl Q(cfsl POST-DEVELOPMENT C I (in/hr) A(acl Q(cfsl 0.35 3.62 2.72 3.44 O=CIA 0.58 3.62 2.72 5.68 Tc= 10 MIN Tc= 10 MIN Vol= (.5)Q(Tc+1 .67Tc) = 45.97 els-min Vol= (.5)Q(Tc+1.67Tc) = 75 .76 els-min Vol (cf)= Vol*(60)= 2758.22 Vol (cf)= Vol(60)= 4545.87 Pre/Post runoff volume difference= 1787.65 CF 66 CY 100-YEAR STORM I C I (in/hr) A(acl Q(cfsl POST-DEVELOPMENT C I (in/hr) A(acl Q(cfsl 0.35 4 .77 2.72 4 .54 O=CIA 0.58 4 .77 2.72 7.48 Tc= 10 MIN Tc= 10 MIN Vol= (.5)Q(Tc+1 .67Tc) = 60.57 els-min Vol= (.5)Q(Tc+1.67Tc) = 99 .83 els-min Vol (cf)= Vol*(60)= 3634.45 Vol (cf)= Vol*(60)= 8984.99 Pre/Post runoff volume difference= 5350.54 CF I 198 CY I ROLOGY FOR APPLICATION OF RATIONAL METHOD GOULD STORAGE W. GLENWOOD 19137 Design Criteria: GARFIELD COUNTY 1/31/2022 :; FOR VARIOUS RETURN PERIODS 2yr 5yr 10yr 25yr 100yr n/hr in/hr in/hr in/hr !.12 3.1 3.89 4 .74 6.52 1.56 2.27 2.85 3.62 4.77 hydro .27 1.84 2.32 2.94 3.88 hydro ).51 0.70 0.85 1.06+ 1.65 hydro ).31 0.41 0.48 0.59 0.74 hydro 1.05 0.07 0.08 0.09 0.11 hydro ).61 0.81 1.18 1.49 .13 1.56 2.16 2.74 Basin D4 Post-Development REA AREA AREA rational Surface AREA AREA AREA rational SF AC % coefficient Basin SF AC % coefficient 3,539 0.08 2 0.90 impv-pave 48 ,621 1.12 29 0.90 1,754 0.04 1 0.90 impv-rool 1,754 0.04 1 0.90 161,605 3.71 97 0.35 perv 116,523 2.68 70 0.35 166,898 3.83 100 Total 166,898 3.83 100 fficient Weighted Rational Coefficient AREA C PRODUCT SURFACE AREA C PRODUCT 0.08 0.90 0.07 PAVEMENT 1.12 0.50 0.56 0.04 0.90 0.04 METAL ROOF 0.04 0.90 0.04 3.71 0.35 1.30 NATIVE LAWN 2.68 0.35 0.94 3.83 1.41 TOTAL 3.83 1.53 0.37 Cw 0.40 2-YEAR STORM I C I (in/hr) A(ac) Q(cfs) POST-DEVELOPMENT C I (in/hr) A(ac) Q(cfs) 0.37 1.56 3.83 2.20 O=CIA 0.40 1.56 3.83 2.39 Tc= 10 MIN Tc= 10 MIN Vol = (.5)Q(Tc+ 1.67Tc) = 29 .32 els-min Vol = (.5)Q(Tc+ 1.67Tc) = 31 .88 els-min Vol (cf)= Vol*(60)= 1759.17 Vol (cf)= Vol(60)= 1912.55 Pre/Post runoff volume difference= 153.38 CF 6 CY 25-YEAR STORM I C I (in/hr) A(ac) Q(cfs) POST-DEVELOPMENT C I (in/hr) A(ac) Q(cfs) 0.37 3.62 3.83 5.10 O=CIA 0.40 3.62 3.83 5.54 Tc= 10 MIN Tc= 10 MIN Vol = (.5)Q(Tc+ 1.67Tc) = 68 .04 els-min Vol = (.5)Q(Tc+ 1.67Tc) = 73 .97 els-min Vol (cf)= Vol*(60)= 4082.19 Vol (cf)= Vol(60)= 4438.11 Pre/Post runoff volume difference= 355.92 CF 13 CY 100-YEAR STORM l C I (in/hr) A(ac) Q(cfs) POST-DEVELOPMENT C I (in/hr) A(ac) Q(cfs) 0.37 4 .77 3.83 6.72 O=CIA 0.40 4 .77 3.83 7.30 Tc= 10 MIN Tc= 10 MIN Vol = (.5)Q(Tc+ 1.67Tc) = 89 .65 els-min Vol = (.5)Q(Tc+ 1.67Tc) = 97.47 els-min Vol (cf)= Vol*(60)= 5379.01 Vol (cf)= Vol*(60)= 8772.00 Pre/Post runoff volume difference= 3392.99 CF I 126 CY I Appendix B SE#. 19137.01 04/21/2022 Page 16 I 502 Main Street • Suite A3 • Carbondale, CO 81623 • (970) 704-0311 • Fax (970) 704-0313 SOPRIS ENGINEERING • LLC civil consultants "' Black Hills Energy Jason Cox Utility Construction Planner Colorado Gas Jason.cox@blackhillscorp.com Feb. 19 ,2020 Re: Glenwood Springs RV Resort@Hwy 6 To Whom It May Concern: Black Hills Energy 0096 C.R. 160 Glenwood Springs,co.81601 This letter will confirm that Black Hills Energy will provide Natural Gas Distribution service to the development. Black Hills Energy will install a distribution system capable of serving the demand of the development that lies within the BHE certificated service territory. This service will be subject to Black Hills Energy tariffs filed with the Colorado Public Utilities Commission and the Black Hills Energy Gas Network Main Extension Policy. If you have any questions please feel free to contact me. Sincl:erely, ~ ,·A~ '(~/' Jaso Co Utility Construction Planner Black Hills Energy Jason.cox@blackhillscorp.com Cell: 970-309-2432 Improving life with energy www.blackhillsenergy.com 12/23/2019 Ashley Dostal, EIT Sopris Engineering, LLC 502 Main Street Suite A-3 Carbondale, CO 81623 PH 970.704.0311 RE: West Glenwood Development To whom it may concern: c~ Centurylinlr Stronger COnnlct8d- Your request for facilities to West Glenwood Development is within Centurylink's serving area and will be provided in accordance with all the rates and tariffs set forth by the Colorado Public Utilities Commission. Connections to Centurylink facilities are contingent upon the customer meeting all the requirements of the Utilities tariffs that are in effect for each requested utility service at the time the application for service is made by the customer and formally accepted by Centurylink. Connection requirements may include provisions for necessary line extensions and/or other system improvements, and payment of all applicable system development charges, recovery agreement charges and other fees or charges applicable to the requested service. Although Centurylink diligently seeks to expand its facilities as necessary to meet anticipated growth, Centurylink services are provided to eligible customers at the time of connection to the facilities on a "first come, first served" basis after acceptance of the customer's application as described above. In certain instances, our facilities and capacities may be limited. Accordingly, no specific allocations or amounts of Centurylink facilities or supplies are reserved for service to the subject property, and no commitments are made as to the availability of Centurylink service at future times. Sincerely, Jason Sharpe Senior Field Engineer 970-328-8290 @omcast January 15, 2020 Glenwood Springs RV Resort Attn: Yancy Nichol Glenwood Springs, Colorado RE: Glenwood Springs RV Resort Glenwood Springs, Colorado Please accept this letter as confirmation that Comcast of Colorado/Florida, Inc. has the ability to provide cable service to the captioned location. The provision of service is contingent upon successful negotiations of an Agreement between the developer and Comcast Cable Communications, Inc. Should you require additional information, please contact Michael Johnson. I can be reached at (970) 930-4713 or by email at Michael_johnson@cable.comcast.com Sincerely, Michael Johnson Construction/Engineering Comcast Cable Communications This letter is not intended to give rise to binding obligations for either party. Any contractual relationship between the parties will be the result of formal negotiations and will only become effective upon execution of the contract by representatives of the parties authorized to enter into such agreements. During any negotiations, each party will bear its own costs and will not be responsible for any costs or expenses of the other party , unless separately agreed to in writing . DocuSign Envelope ID: 02294733-8EED-454D-A6E4-0B943A97383B February 10, 2022 MMMEWG, LLC 6874 Hwy 82 C O L ORA D O Depa.rtrnentof Transportation Region 3 Traffic, Access Unit 222 S 6 th St, Rm 100 Grand Junction, CO 81501 PH 970-683-6284 FAX 970-683-6290 <« E-mailed»> Glenwood Springs, Colorado 81623 RE: State Highway Access Permit No. 320017 located in Garfield County on Highway 070A near Mile Reference Pt. 113.147 Left Dear Permittee, Section 2.4(5) of the State Highway Access Code states : "When necessary to amend a permit, and the Permittee is agreeable and waives the right to an administrative hearing on the amendment, a letter detailing the amendment with reasons for the amendment shall be prepared . The letter of amendment requires the approval of the issuing authority, the Department, and the Permittee." The access permit referenced above is hereby amended to include, change, add, or omit the following: Omit the following Land Use and Volume (from the previous amendment): 210 -Single Family Home -76 homes 78 DHV Add the following Land Use and Volume: 210 -Single-Family Detached -2 homes 151 -Mini-Warehouse 134,000 Sq . Ft . Total 2 DHV 39 DHV 41 DHV The undersigned parties agree to the permit amendment as described above. The Permittee waives the right toan administrative hearing on the amendment. There are no other forms or verbal agreement. This form and the permit documents constitute the complete agreement . Permittee/Property Owner (Print Name): iTitle: Mark Gould owner I ~lll!~lzrty Owner Signature: Date: 3/8/2022 I 10: 19 AM PST ~JP~r ~ifftl~t Print Name): iTitle: C:o-Permittee Signature: Date: C:DOT Authorized Representative Print Name: rntte: Kandis Aggen Asst. Access Manager C'l'm 'l"¾l\'ltfi'a'rized Representative Signature: Date: ~~Ck-3/8/2022 I 10:46 AM PST 81CF3858529F4D5 ... Civil Plan Set Sopris Engineering 5780575 0 57 8 0 5750 5760 5770 57205730574057305720571057 3 0 57 2 0 5710 57405730 5770 5790 5780 5760 5770 5790 5800 57605770 57905800 5690 5690 5748 5746 574 4 5738 5764 5768 5770 57705760576057805800 5794 5784 5776 5794 5760 5770 5750 5790 5792 57 9 0 5798 57705746 5780 ue ueueueue ue ue ue ue ue ueueueoe oe oe oe oe oe oeoeBUREAU OF LAND MANGEMENT STORM KING HUNTING RANCH LLC REC. # 658533 RICHARD DEVER REC. # 570056 BURIED ELECTRICAL LINE30' ACCESS AND UTILITY EASEMENT 10' MTN STATES TELEPHONE EASEMENT ELECTRIC VAULT ELECTRIC TRANSFORMER 12X16' WELL BUILDING DEVER WELL #1 EXISTING LEECH FIELD EXISTING RESIDENTIAL STRUCTURE BURIED PROPANE TANK FIRE HYDRANT WELL BUILDING 12X13' DEVER WELL #3 30' ACCESS EASEMENT 14' POWERLINE EASMENT 18' POWERLINE EASEMENT PARCEL A 24.42 ACRES ± PARCEL B 14.48 ACRES ± AMICHAUX LIMITED PARTNERSIP LLLP HIGHWAY 6&24 INTERSTATE 70 WEST BOUND EXISTING CULVERT EXISTING CULVERT EXISTING CULVERT EXISTING CULVERT EXISTING CULVERT EXISTING CULVERT EXISTING CULVERT 150' STOCK DRIVE WAY EASEMENT OVERHEAD ELECTRICAL LINE OPRIS ES NGINEERING, LLC. CIVIL CONSULTANTS 19137.01JOB NO. DATE: 502 MAIN STREET CARBONDALE, CO 81623 (970) 704-0311 FAX: (970)-704-0313 DESIGNED BY DRAWN BY CHECKED BY AD AD YN DATE REVISION C-1.0 DRAWING NO. TITLE G:\2019\19137\CIVIL\CIVIL DWGS\PLOT\LIMITED IMPACT REVIEW\19137 C1.0 EXISTING CON.DWG - Mar 31, 2022 - 8:27amNORTHEXISTING CONDTIONSROYAL MINI STORAGE AT CANYON TERRACESGARFIELD COUNTY, COLORADOLIMITED IMPACT REVIEW1 inch = ft. ( IN FEET ) GRAPHIC SCALE 075 75 150 75 30037.5 MEMBER UTILITIES FOR THE MARKING OF UNDERGROUND BEFORE YOU DIG, GRADE, OR EXCAVATE CALL 2-BUSINESS DAYS IN ADVANCE .QRZZKDW V 5 04-15-22 02/11/22 02/11/22 04/15/22 PROPERTY LINE PROPERTY LINE PROPERTY LINEPROPERTY LINE PROPERTY LINEPROPERTY LINEC below all before you· d' 19. xxxxxxxxA1 A2 A3 A4 A5 A6 A7 OUTDOOR STORAGE EXISTING LEECH FIELD EXISTING WELL PROPERT Y L I N E PROPERTY LINE PROPERTY LINE PROPERTY LINE PROPERTY LINE PROPERTY LINEC1 C2 C3 C4 EMPLOYEE HOUSING OFFICE EXISTING HOME WESTBOUND INTERSTATE 70 HIGHWAY 6&24 C5 B1 B2 B3 B4 B5 B6 B7 B8C2.1OPRISESNGINEERING, LLC. CIVIL CONSULTANTS 19137.01JOB NO. DATE: 502 MAIN STREET CARBONDALE, CO 81623 (970) 704-0311 FAX: (970)-704-0313 DESIGNED BY DRAWN BY CHECKED BY AD AD YN DATE REVISION C-2.0 DRAWING NO. TITLE G:\2019\19137\CIVIL\CIVIL DWGS\PLOT\LIMITED IMPACT REVIEW\19137 C2.0 SITE PLAN.DWG - Mar 31, 2022 - 8:30amNORTHOVERALL SITE PLANROYAL MINI STORAGE AT CANYON TERRACESGARFIELD COUNTY, COLORADOLIMITED IMPACT REVIEW1 inch = ft. ( IN FEET ) GRAPHIC SCALE 075 75 150 75 30037.5 MEMBER UTILITIES FOR THE MARKING OF UNDERGROUND BEFORE YOU DIG, GRADE, OR EXCAVATE CALL 2-BUSINESS DAYS IN ADVANCE .QRZZKDW V 5 SHT C2.3 SHT C2.2 SHT C2.4 SHT C2.1 C-2.1 C-2.2 C-2.3 C-2.4 04-15-22 02/11/22 02/11/22 04/15/22 / r I I -u " • - I 1 \ " / I / / ~ I ~ \ \ • 'I / I!\ \ -- below. Call before you dig. xxx >>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>> >>>>>>>>>>>>>>>>>>>>>>>>>>>>>>> >>>>>>>>>>>>>>>>>>>> x xxxxxx xxxxxPROPOSED SECURITY GATE OFFICE BUILDING EMPLOYEE HOUSING CARPORT SPACE FOR EMPLOYEE HOUSING PROPOSED FENCE BETWEEN BUILDINGS A1 A2 A3 A4 A5 A6 A7 HIGHWAY 6&24 R25' 200' 200' 240' 120' 120' 200' 200' 30' 40' 30' 23' 23' 23' 30' 40' 30' 40' 40' 36' 23' 24' 24' R20' R20' R5'R5' R25' 40' 40' 30' 23' 23' 12' 17' BASIN 3C BASIN 3D OPRIS ES NGINEERING, LLC. CIVIL CONSULTANTS 19137.01JOB NO. DATE: 502 MAIN STREET CARBONDALE, CO 81623 (970) 704-0311 FAX: (970)-704-0313 DESIGNED BY DRAWN BY CHECKED BY AD AD YN DATE REVISION C-2.1 DRAWING NO. TITLE G:\2019\19137\CIVIL\CIVIL DWGS\PLOT\LIMITED IMPACT REVIEW\19137 C2.0 SITE PLAN.DWG - Mar 30, 2022 - 4:15pmNORTHSITE PLAN PHASE 1ROYAL MINI STORAGE AT CANYON TERRACESGARFIELD COUNTY, COLORADOLIMITED IMPACT REVIEW1 inch = ft. ( IN FEET ) GRAPHIC SCALE 020 20 40 20 8010 MEMBER UTILITIES FOR THE MARKING OF UNDERGROUND BEFORE YOU DIG, GRADE, OR EXCAVATE CALL 2-BUSINESS DAYS IN ADVANCE .QRZZKDW V 5 SHT C2.3 SHT C2.2 SHT C2.4 40' 30' 04-15-22 02/11/22 02/11/22 04/15/22 3' VALLEY PAN (TYP) SWALE (TYP) • / • --- ------ ' I - , \ 1171 ~ • • • , , --- ---- --- • • • , 4 ,. , • • , , , • • • , • , I ----------------==-=-- ---------- --.......___ --.......___ ------------ I I I \ \ I I I I ------- I " -~--------------- ------ \ \ .......... ------- ------------------ --------.......___ --.......___ ------------- -------- 4 , , 4 , 4 4 , , • • 4 4 --/ ------------- ------------------------- ---------- ---------- , ' • , • ------ --------------- , I l • -- ------- . , I I \ , - --- , • • • , , , • , • • 4 • • • , • , , , ' 4 , -- • , • . , ( I I I I I I ) • • , , .. --- • ' , , 4 .. ., -------- • • , • • 4 ' • , , ' ' • , , • • • , ---- • d • 4 ' • • , • , • ---- , • <1 "4· • , , , • , • ----- , , , • • • rr,r, ------- 4." , 4 , • , I • , 4 4 • , , . • , , • • , • . . , 4 , , • , , • , • • ' , • 4 below Call before you· dig. HWY 6 >>>>>>>>>>>>>>> >>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>x x x xxxxxxxxxPROPERTY LINE PROPERTY LINE200' 200' 160' 160' 200' 40' 40' 23' 23' 23' 30' 40' 40' 30' 40' 40' 40' 40' 40' 40' 30' 200' 200' 200' 3' VALLEY PAN 3' VALLEY PAN 3' VALLEY PAN B1 B2 B3 B4 B5 B6 B7 B8 SWALE (TYP) FENCE BETWEEN BUILDINGS (TYP) STORM WATER DETENTION HWY 6 I-70 I-70 EMPTY FIBER CONDUITS oe8''WL8''WL8''WL8''WL >>>>>>>>>>OPRIS ES NGINEERING, LLC. CIVIL CONSULTANTS 19137.01JOB NO. DATE: 502 MAIN STREET CARBONDALE, CO 81623 (970) 704-0311 FAX: (970)-704-0313 DESIGNED BY DRAWN BY CHECKED BY AD AD YN DATE REVISION C-2.2 DRAWING NO. TITLE G:\2019\19137\CIVIL\CIVIL DWGS\PLOT\LIMITED IMPACT REVIEW\19137 C2.0 SITE PLAN.DWG - Mar 30, 2022 - 4:27pmNORTHSITE PLAN PHASE 2ROYAL MINI STORAGE AT CANYON TERRACESGARFIELD COUNTY, COLORADOLIMITED IMPACT REVIEW1 inch = ft. ( IN FEET ) GRAPHIC SCALE 020 20 40 20 8010 MEMBER UTILITIES FOR THE MARKING OF UNDERGROUND BEFORE YOU DIG, GRADE, OR EXCAVATE CALL 2-BUSINESS DAYS IN ADVANCE .QRZZKDW V 5 SHT C2.3 SHT C2.1 SHT C2.4 04-15-22 02/11/22 02/11/22 04/15/22 • • 4 • • • 4 • • • • • 4 • 4. • . • • • • ' . . . • • • 4 • • 4 • • 4 • - 4 • • • 4 • • • • • • 4 • • • 4 • • 4 d y 4 • • • • 4 • • • 4 • . . • - . . • • • . . • .. • - . . . • • 4 • d " ., ;, d .. • • • - • • A • • • • • • • • • • • • • • 4 • • • 4 • • • • • • • • • A • • • • •• • . . • • , • • A ' 4 • • . . ., . . • 4, • 4 • • • • 4 • • ' • 4 ' • • 4 • • • • 4 • • ,.4 • • • • ., • 4 • • 4 • • • . . • A • • • 4 4 - <l • • • • • A • • • . . . . • \.· J • • .. • • - • • • A • A • "'·"-ll • - , • 4 • • • ' • • 1 • • • - <l • 4 - • ' • ". LI • • • • .. • A • • - • 4 • • • ' • .. • • • • A • • 4 ' • • • • • - J • • • • • . • • • • • A • • • • • - • • ·• • • • • A • • • I • • • • .. • • • • • I ( I I I I I I I I I I \,. -- 1 1 - \ I I I I I I I I I ) I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I ~---c_ __ _ I :._;;;;/ . I ,-o I ·,!I below. Call before you dig. EMPTY FIBER CONDUITS>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>> >xxxxxxxxxxxxx x xxxxxxx xR20' R20' PROPERTY LINE PROPERTY LINE PROPERTY LINE C1 C2 C3 C4 C5 280' 280' 240' 40' 40' 160' 160' 40' 30' 30' 40' 40' R20' R20' 23' 23' 23' DEBRIS BASIN 2 40' 40' 3' VALLEY PAN (TYP) R20' R20' DEBRIS BASIN 1 24' 24' FENCE (TYP) HWY 6 I-70 I-70 EMPTY FIBER CONDUITS oe8''WL8''WL8''WL8''WL >>>>>>>>>>OPRIS ES NGINEERING, LLC. CIVIL CONSULTANTS 19137.01JOB NO. DATE: 502 MAIN STREET CARBONDALE, CO 81623 (970) 704-0311 FAX: (970)-704-0313 DESIGNED BY DRAWN BY CHECKED BY AD AD YN DATE REVISION C-2.3 DRAWING NO. TITLE G:\2019\19137\CIVIL\CIVIL DWGS\PLOT\LIMITED IMPACT REVIEW\19137 C2.0 SITE PLAN.DWG - Mar 30, 2022 - 4:39pmNORTHSITE PLAN PHASE 3ROYAL MINI STORAGE AT CANYON TERRACESGARFIELD COUNTY, COLORADOLIMITED IMPACT REVIEW1 inch = ft. ( IN FEET ) GRAPHIC SCALE 020 20 40 20 8010 MEMBER UTILITIES FOR THE MARKING OF UNDERGROUND BEFORE YOU DIG, GRADE, OR EXCAVATE CALL 2-BUSINESS DAYS IN ADVANCE .QRZZKDW V 5 SHT C2.1 SHT C2.4 SHT C2.2 04-15-22 02/11/22 02/11/22 04/15/22 SWALE (TYP) • • cl • I -• • • • • • • • • • • • • .. • • • • . . • • . . • • cl • • • • • • • • • • • • • • • 4 cl • J • • • • • • • • . . • • • . . • • • • • ,,. .., <l .. • • • • • • • • • • • • • • / I l \. • ------------ . . • • • - • • • \ . .,_ .. cl • .. ------- \ \ • \ \ • • • --- • • • • • • --------------- ----------r------------------ ----- • • • . 4 .-.---·-..! • ( \ \ ) I • • • • • • • • . . • • • --- • • • • • • i1r r ____ _J'/,, ,, rr,r, ------------ .. • i.....:·:.· ;...J..-1---· • • • . . • • • • • • • • • • ~ \ • • . . _l • • \ \ \ \ \ \ \ • • • C below all before you· d' 19. xxxxOUTDOOR STORAGE EXISTING LEECH FIELD EXISTING WELL EXISTING PROPANE TANK R25' R10' R20'R25' R20' R25' 278' 188' 10' 20' 20' 40' 24' PROPERT Y L I N E OUTDOOR STORAGE R20' DEBRIS BASIN 1 PROPOSED WALL FOR ROCKFALL MITIGATION EXISTING DRY HYDRANT DEBRIS BASIN 1 HWY 6 I-70 I-70 EMPTY FIBER CONDUITS OPRIS ES NGINEERING, LLC. CIVIL CONSULTANTS 19137.01JOB NO. DATE:04-15-22 502 MAIN STREET CARBONDALE, CO 81623 (970) 704-0311 FAX: (970)-704-0313 DESIGNED BY DRAWN BY CHECKED BY AD 02/11/22 AD 02/11/22 YN 04/15/22 DATE REVISION C-2.4 DRAWING NO. TITLE G:\2019\19137\CIVIL\CIVIL DWGS\PLOT\LIMITED IMPACT REVIEW\19137 C2.0 SITE PLAN.DWG - Mar 30, 2022 - 4:46pmNORTHSITE PLAN OUTDOOR STORAGEROYAL MINI STORAGE AT CANYON TERRACESGARFIELD COUNTY, COLORADOLIMITED IMPACT REVIEW1 inch = ft. ( IN FEET ) GRAPHIC SCALE 020 20 40 20 8010 MEMBER UTILITIES FOR THE MARKING OF UNDERGROUND BEFORE YOU DIG, GRADE, OR EXCAVATE CALL 2-BUSINESS DAYS IN ADVANCE .QRZZKDW V 5 SHT C2.3 SHT C2.1 SHT C2.2 30% SLOPE LINE \ 0 _/ - --~/ fr/ t I I I I \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ j ! 0 i! ' ' • rur, , -........ ........... ........... \ '\ '\ '\ '-......._ ......._ ......._ ........... --- ~ I I I I I below. ~ ----~~~ Callbeforeyoudig. oe oe oe oe oe oe oe oe oeoeUEUExxxxxxxxUEUEUEUEA1 A2 A3 A4 A5 A6 A7 B1 B2 B3 B4 B5 B6 B7 B8 PROPOSED DETENTION POND EXISTING LEECH FIELD EXISTING WELL C1 C2 C3 C4 OUTDOOR STORAGE EMPLOYEE HOUSING OFFICEEXISTING HOME WESTBOUND INTERSTATE 70 HIGHWAY 6&24 C5 OPRIS ES NGINEERING, LLC. CIVIL CONSULTANTS 19137.01JOB NO. DATE:04-15-22 502 MAIN STREET CARBONDALE, CO 81623 (970) 704-0311 FAX: (970)-704-0313 DESIGNED BY DRAWN BY CHECKED BY AD 01/28/22 AD 01/28/22 YN 04/15/22 DATE REVISION C-3.0 DRAWING NO. TITLE G:\2019\19137\CIVIL\CIVIL DWGS\PLOT\LIMITED IMPACT REVIEW\19137 C3.0 GRADING.DWG - Mar 30, 2022 - 8:39pmNORTHOVERALL GRADING PLANROYAL MINI STORAGE AT CANYON TERRACESGARFIELD COUNTY, COLORADOLIMITED IMPACT REVIEW1 inch = ft. ( IN FEET ) GRAPHIC SCALE 075 75 150 75 30037.5 MEMBER UTILITIES FOR THE MARKING OF UNDERGROUND BEFORE YOU DIG, GRADE, OR EXCAVATE CALL 2-BUSINESS DAYS IN ADVANCE .QRZZKDW V 5 3a 3b 3c 3d 2 1B 1A ,,. '--.,..-- " ----- , '- "' > .-: ;•:;; ', C •:c+.: .. C· -!,:·,' _ _.' _,,")/\ •:_.·._ ,:_;'_~-~ ~ ·-'i:l:. ._; '.,,....-\ / ;;1/ ~-.;,:/.' ' '-..._ . ,,_:•, / // / _,../ / // -- ~ / ~ ~ / -/ / / - L------~ ; ,,.......'-_ ---..... \ --- below. Call before you dig. xxx >>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>> >>>>>>>>>>>>>>>>>>>>>>>>>>>>>>> >>>>>>>>>>>>>>>>>>>> x xxxxxx xxxxx5770 5790 5780 5770576057805800 5794 5770PROPOSED SECURITY GATE OFFICE BUILDING EMPLOYEE HOUSING CARPORT SPACE FOR EMPLOYEE HOUSING A1 A2 A3 A4 A5 A6 A7 HIGHWAY 6&24 FFE:5775.30' FFE:5774.80' FFE:5774.30'FFE:5773.80' FFE:5773.30' FFE:5775.30'FFE:5774.80'FFE:5774.30' FFE:5773.80'FFE:5773.30' FFE:5773.30'FFE:5773.80'FFE:5774.30'FFE:5774.80' FFE:5775.30'FFE:5775.82' FFE:5772.50' FFE:5771.50'FFE:5771.00'FFE:5770.50' FFE:5772.50' FFE:5772.00' FFE:5771.50' FFE:5771.00'FFE:5770.50' FFE:5772.64' FFE:5772.00' FFE:5771.50'FFE:5771.00' FFE:5770.55' FFE:5771.51' FFE:5771.04' FFE:5770.59' 1.0% 1.0% 1.0% 1.0% 1.0% 1.1% 1.0% 2.5% 2.5% 2.5% 2.3%57701.0% 1.0% 1.0% 1.0%1.0%2.0%-2.7:1-2.2:1-2.2:1-2.1:1-2.2:1-2 .3 :1-2.0:1-2 .0 :1-1.6:15760 5750 57 9 6 58 0 0 5804 5794 577457725780 57781.0%2.1%1.0%6.7% 6.7%0.1%6.7%0.0%1.0%1.3% 2.0% RIM:5774.24' RIM:5774.93' RIM:5774.37' RIM:5773.57' RIM:5773.30' RIM:5772.44' RIM:5772.11' RIM:5772.29' RIM:5771.60' RIM:5770.71' RIM:5771.37' RIM:5770.63' RIM:5770.61' RIM:5771.37'57605750577057765.5%5.7%7.8%0.2%5.8%0.0%1.0%1.0%1.0%1.0%1.0%1.0%3.1% 3.1% 2.1% DAYLIGHT: 5750.25' RIM:5775.17' RIM:5775.17' INV IN: 5794' INV OUT: 5774' INV IN: 5764.5094 LF OF 60" ADS N-12 SMOOTH WALLED PIPE @ 20.9%210 LF OF 60" ADS N-12 SMOOTH WALLED PIPE @ 6.8%12.0%10.7%3.7% 3.0% 5.5% 2.9% RIM:5771.09' 3.5% 3.8% 4.2% 1.0% 1.0% HWY 6 I-70 I-70 EMPTY FIBER CONDUITS OPRIS ES NGINEERING, LLC. CIVIL CONSULTANTS 19137.01JOB NO. DATE:04-15-22 502 MAIN STREET CARBONDALE, CO 81623 (970) 704-0311 FAX: (970)-704-0313 DESIGNED BY DRAWN BY CHECKED BY AD 01/28/22 AD 01/28/22 YN 04/15/22 DATE REVISION C-3.1 DRAWING NO. TITLE G:\2019\19137\CIVIL\CIVIL DWGS\PLOT\LIMITED IMPACT REVIEW\19137 C3.0 GRADING.DWG - Mar 30, 2022 - 9:10pmNORTHGRADING AND EROSION CONTROL PLANROYAL MINI STORAGE WEST GLENWOODGARFIELD COUNTY, COLORADOLIMITED IMPACT REVIEW1 inch = ft. ( IN FEET ) GRAPHIC SCALE 020 20 40 20 8010 MEMBER UTILITIES FOR THE MARKING OF UNDERGROUND BEFORE YOU DIG, GRADE, OR EXCAVATE CALL 2-BUSINESS DAYS IN ADVANCE .QRZZKDW V 5 SHT C2.3 SHT C2.2 SHT C2.4 30% SLOPE LINE I / I / / / / / / ----- / I / / - - I I / / / / I 1 ---'-I- l-t-- / I \ --- / / -- I 7 / ------- \ 1/1 /1 I I I I I I i /;1 1 I I I I I ) I I I ;I 1 I I ,1 1 I I ________ __....,.,,,.. /I I ----'--- \ \ I I I / / I 4 ' • ' \ / / . I d "; <l , / I / I I -r- 1 I I / I I I I / / / I / / / I / _;_ I I I / / / / / / I / / / / / / I / / / I / / / I / / / / / / / / I I / I I ---- ,,,----- I / I / I / / / I / / / I / I I / I I / / I / I I I . /. . / / • / • . .,, / / / / /• • • • ,,,,,,----_ __., / / .,.,,,,.----/ 1 =~\=j '-..=:=;;:::::-;;;;=---~:::=::===s~~="==-~=/=/:==/=/==~:::=:/=:~\-~~;J,'-..~---_/--~~/.;;;..:.,,,~,,,::-1..,,,:::.~~,~'"::"'~--=======t\~-~~=~=,,..:::/:::~ I I / y / / - • • • • / • "./ below. Call before you dig. HWY 6 >>>>>>>>>>>>>>> >>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>x x x xxxxxxxxx5750 5760 5770 57205730574057405730 5748 5746 574 4 5738 5764 5768 5770 576057605746 5780 B1 B2 B3 B4 B5 B6 B7 B8 PROPOSED DETENTION POND PROPERTY LINE PROPERTY LINE2.5% 2.5% 2.3% FFE:5769.92'FFE:5769.20'FFE:5768.70' FFE:5768.20' FFE:5767.70' FFE:5766.90'FFE:5766.40' FFE:5765.90'FFE:5765.40' FFE:5764.90' FFE:5765.40'FFE:5765.90'FFE:5766.40' FFE:5766.90' FFE:5767.70' FFE:5768.20' FFE:5768.70' FFE:5769.20' FFE:5769.70' FFE:5769.70'FFE:5769.20' FFE:5768.70' FFE:5768.20' FFE:5767.70' FFE:5766.90' FFE:5766.40' FFE:5765.90'FFE:5765.40' FFE:5766.90'FFE:5766.40' FFE:5765.90'FFE:5765.40' FFE:5764.90' FFE:5769.70'FFE:5769.20' FFE:5768.70' FFE:5768.20' FFE:5767.70'57705750 57405768 5766576257605770 57561.0% 2.5% 2.5% 2.5% 1.0% 1.0% 1.0% 1.0% 1.1%1.0%1.0%1.0% 1.0%1.0%1.0%1.0%1.0%1.0%1.0%1.0%1.1%1.1%1.0% 1.0%1.0%1.0% 1.0%1.0%1.0%1.0%1.0%1.0%1.0%1.0%2.0% 2.0% 2.0%0.0%-2.1:1-2.1:1-2.0:1-2.1:1 -2.4:1 -2. 3 : 1-2.0:1-2.0:1-2.2:1RIM:5769.67' RIM:5769.29' RIM:5769.67' RIM:5769.29' RIM:5769.67' RIM:5768.69' RIM:5767.88' RIM:5766.75' RIM:5765.83' RIM:5764.78' RIM:5764.87' RIM:5764.87' RIM:5765.88'RIM:5766.69' RIM:5767.88' RIM:5768.67' RIM:5768.69' RIM:5767.88' RIM:5766.48' RIM:5766.63' RIM:5766.49' RIM:5765.88' 5770 5776 576857665764 5766 5760575057405760 5750 5740 5730 576057705780 OPRIS ES NGINEERING, LLC. CIVIL CONSULTANTS 19137.01JOB NO. DATE:04-15-22 502 MAIN STREET CARBONDALE, CO 81623 (970) 704-0311 FAX: (970)-704-0313 DESIGNED BY DRAWN BY CHECKED BY AD 01/28/22 AD 01/28/22 YN 04/15/22 DATE REVISION C-3.2 DRAWING NO. TITLE G:\2019\19137\CIVIL\CIVIL DWGS\PLOT\LIMITED IMPACT REVIEW\19137 C3.0 GRADING.DWG - Mar 30, 2022 - 9:20pmNORTHGRADING PLANROYAL MINI STORAGE AT WEST GLENWOODGARFIELD COUNTY, COLORADOLIMITED IMPACT REVIEW1 inch = ft. ( IN FEET ) GRAPHIC SCALE 020 20 40 20 8010 MEMBER UTILITIES FOR THE MARKING OF UNDERGROUND BEFORE YOU DIG, GRADE, OR EXCAVATE CALL 2-BUSINESS DAYS IN ADVANCE .QRZZKDW V 5 SHT C2.3 SHT C2.1 SHT C2.4 EXISTING WELL EXISTING 30% SLOPE LINE I I I I I I I / I I I I I I I I I I I \ I \ I I I I I 11 I I I I I I I I I I I \ I I I I I I I I ) I I I I I I \ I I I I I I I I I I \ I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I / / I I I \ I I I \ "" '---ti i ~ ~ I / \ \, / ~ \ \ ' \\ \t I \ I \ \1 \1\ i \\ \ /r ~ \ ,, I I \ I\ I\\ /\I 'I i ! i , I ' \ \I \ [11 \( I 1, I / Ii v ,,, ,, ·, /\ \I I 1\ \ \ \\ I\ '\ \ I\. \ \ ,"-'-I \ \ \ I i I I \ l"\1 \ I I \ \\ \\ I \ I I \ \ \I \ \'\ 11 I \'\ \ '\ r\ I \I\ \\ I I \ \ ,I \ I " i? ., t,. .~\" ' ,, ' / ,.--~ -',;,. .. ,, ' '\ ' .. t,. ,,. ... • \ \ \. ,, . . . .. --........ .. i,. -b> -"' I c..:.._ t> ,. ' . ·" .. ',. . . . --:: ~ "' ' . . --.., . \ \.• ~· . " . . . . " .. . ' . . . '\' • , •• ~· 0 b • "z' o "· b , , 'S, b o \ • .. 0 . ' ' ~ ' . "· ' . . ' --.., ~ . \ ,. . . . . • ' i' . . . " . • • ' '\ .. '\ ·6... .. ·1:,..A\, \ ·\·\.: '-._: ,. · >, ",l \"1, ... "'-. ,. ' \ . . "'· . , I \ •• • ·, ·--·1 ', -is:-. .. "" Ii .. / ., .. >< I:""' . ... _ .. I ........._ ---..__,., ti • ;c-• ~ •' • ,f / ' -/ ~ t> -.. ~ • / \I I \.. -,.-r ,, 1, \ ~ •• ·-• • I • ------• . • • '..,: /,I>~ • • ". . ~ \ . " \\ \ \\ "'\'---,,+---''.,:,.•.,....:•~1,-.,.i \ I \ \I • ' ' • • ''\ • ' ' • • .... ~.:>~-..Iii\ ' ., " ' • • ,,. • • ',, ' ••• ., • • • b l -" . ' '' .. ' ' ,. ' ., ,. . ' ' .. ' ' • • '-• .• . ' ."'-,\. • • ,•I • '.:. 4 ' '-' · ·"'-I 4 • ,\•'. . \. . . '\ . \ • • . • • I i ,'\ '. . . \ . .\· ' "• \ I I ' ' . ~ .. "-."' .. \ ~~ b • \ ,_,• •·1 ·, . "-. .. • :• .. ),, _,.,. i \ .. ~ ~ . .. ,,. . -' -~ ' • • I \ '\ .. 'l\ ' \ \ . ; ' I \ '1 \ \ ,\' ' \ \ ",,, ., b •1 b •'~ ... "-/· "-. ~· ', . ~,-. } • " • \ \ 1 •• • •' \ \ '\ I \ I " ' ,\ • . \ \ \ . : I I \ ', ' • • ' '\_,_. \ \ • \ • • \ \ I I ·• \' . • \ , • • \ I '. • '\ \ ,. • • ' ' • '\ \ • ' • \ \ I I I• \ \ '\ ""\ "' '\ \ • \ • • \ '< \ • \ • I'. • , "" ,, • " • \ i ,: " \\ \ i I . . \ \ '\ . '' . '\ '\ . . \ \ • • • • • , , ----• • " l--__ _,,__ __ _,,___--1' \• • " \ i I '\ ' ,.. ' \ '· I '\ ' •'\ ·' ,\. \ I " "' • "' • , \ ,\ \ \ \ \ i I ' " • . \ " . .• . . ' I I \I I I I ,1 I \ ~ 11 I \ I I \ I I I \ \ \ I I I \ I , I I\\\ \\I\ \l\l\l\\1\1\\ \ 11 '11\ 1111 \ \l\\111)\I\I\ \\\ 1111 1\1\ \ I I I I I I I I \ I \ I I I I I I I ( I I \ I \II 11\I \I\\ 111\1111\1111 1111 \\II \111 I 111\11\\\1111 1111 \\II \111 I 111\111\\11\ 1111 11\\ \\\ I 111\111\\\1\ \ 1111 \111 11 1111\1111\1\ 1111 \111 \\ I \ I \ \ I \ I \ \ \\ I \ I I I \ \\ , "' \ 11,1\\\\'\ \ \ I \ \ ' \\\'\'' \ \ \ ~' ", ' I \ '\ " ' ', ', \ \ \ \ ' '\ ' ' ,... 1llo..._ '\. ........_ -~ -..... ........_ \ ' I I I ! I I I I I I I j \ \ 1' I \ •• "'-., ·. \ ' . ~ • \ \ \ . \ \ 11 ' \. ,• \ \ •• \ I , ·, \ \ I,:· \·• \ I ', ·• \ '·. ~. I I I\ \ \ I \ \ '-. 'I \ I I I I I I I I \ I I I I t \ I I I \ \ I I I I I \ \ 1 I I I I I \ \ \ \ I I I I I 11 I I I \ I ) 1 I I I I I I I I I I I I I I I I I ~ I I I \ I I I I I I I : I \ I I I I I \ I 11 \1 I I I I \ II \ I I I \ ~ I I 1 I / I I 1\ \ / , I ,\J '\ \ ·,, / \ \\\ ';' ( ·-, r-\ I \ \ I I \ I ,I ,\ I I \ \l I \ \ I I ? \ \ ,.-I_ \ I I 1\ \ ,\ \ /' I \ I \ I \ ,, /\ \1 \ ,\ J I \ \ \' 11 '\ \ \ \ ' \ \ I \ \ \ \ ,\ '-. ,, I \ I I \ \ ,, \ \ ,, \ ' \ \ \ ,, ' '\ • \ , ', · ... \ \ I \ ·. \ J : I I '----• .. \ I ---.., I· ,0. ~-;,_ •• ' ' • " • I \ 11 \ 0-: , ' •, • \" \ \ \ •I, . I' I I I "" ', • \ . . \ \ I ' , .1 I I / \ I h-----~,-----:t, . _..__\ 1----'--...---+--:t \, • I' i----'----1--1 I , " ;,, • •. \ I \ ,\ I I / \1 , \ ~• \ \ \ \ • \ · • \ I I 11 \ \ I I \ ' , .. ' "\' 4 ,_.ti,. . \ ;, --.., . 4.. t,._ '·1 \ \ \ .. \ . . ,I \ \ ' \ i. . . • \ \ I \ I \' ' \ •, I I I I . \. . '\ I \ \ I I • \ \ . • · I I \ \ • \ "' I I ' " I I I ' , I \\ ~ \ \ \ I \ '--''\ 4 • 's----, \ \ • , . • I ; . \ I \ • \ •, \ \ • •\ I I\ I \ • I I \ " • • \ \ 11 ,· \ ( . • ,. 1· • • \ I I \" " \ I \ . " l-----------1· ' \ ', I \ • • I '\ I \ \ \ \I \ I • ) I "-r-.._ _..--..........J .. ~ ,, 1\ • I. \ .. · "-~1 ' • • • ' • • b ,. . \. . --.., " . ·1· I i \ .\ \ \ I I • I \ : • '\ • \ \ \ ' ,\ \ \ \ \ I \ \ ~\· \• \ \ \ \ \ \ \ \ ' . l \ \ \ . ·~ . 'I \ \ I I \ . ·\ . . \ \ \ . , \ \ ' \ • \ • \ \ I \ \ • I \ ••• \ \ ,1 \ \ .. \ I \ '\" • \ \ I I \ \ I /------b. .... '\ \ • '. \ I \ ,I ' . \ \ \ \\ '\ \ \ : . . \ I \ I \ I I " \ \ • I I \ •\ , \ I I\ '' ., \ \ . . \ ., . \ \ ----.. . \ \ \ '\ . \ \ . \ .. '\ • . •, \ \ . \ ' ·• I \ I • ' \ \ ~ \ \ ' \ I • I• • \ I I , I I I 1 / ,, •• I ; \ \ .,__,.-/ '\ '\• I \ ,.. • ' \· ' • • • \ '\ I I /\'•• . \ '• \ \ ,· I '--._,.-/ \. I ,\ • '\ \ \ \,. \ I I '• \ \ I •· '. " \ \ ~. \ \ 1 I \ I , • \ \ ·\ .\ \ . . \ \ \ . . ' ' . \ \ I . \ • \'. \ I I \ '! \ \ \ t t" • , I \ I' , • I \ 1 I •,'f \ I • I \ \ I •,.1· \• \ I I I I ~· \ ' 1, \ ,. -(___ I \ 1•. \ I ~ ,"\ I / ,___: \ . ~1---...:.---~--..µ..---c---.\-..:,___!,-1----i--_,,,.-~1 I/ \ \ I I I \ I \ \ I \ I \ \ ' ~ I \ I \ \ 11\ I \ II I \ \ I I '\ \ \ \ \ I \ \ I \ I I \ \ \ \ I I I \ '\ I \ \ \ \ '----\ \ I I I I ' / ~" '\ ' I I ( ( \ ~ I I \ \ '\ " -\ "\ ' \ \ \ I \ I '\ \ ---------, ""-------\ \ \ \ I \ \ I I I I I I I \ 1/<:'\ ~ ~ I I ( I I I \ I I I I \ \ I / \ I \ ' " ' \ \ \ : , I i1 I I I \ "' I \ \ \ I I I I I I I \ I I \ \ I I I I I I I I \ I I \ I I I \ \ \ \ I I I I I I I \ \ I I I I \ I \ \ I \ 11\ll\1 \\ ll\11 \ \ \ I I \ / I I I I \ I I I \ \ I \ I I I I I I I \ I \ \ I \ I I \ I I \ I \ I I \ \ / / / / I ., / / / d I I I \ \ I l \\ /"111\\ 'i"--\ I • . • --'--'--. ' . ' ' ' .· ,\, b. b. ):, /> I::, • •' . • • • ·' • ,· I . \. • . • \' • ·.• • • • I l. • , . , . . , · \ . . . I " • I •• . I· • ,. · , I 1>. I \' '\ • \ • • • \ • ' • 'I " • • • •• '\ •• I'' '\· • I I .,. .. ~-I> • \. , • •. I •. . • •\ . ·'' \.. • • • I • I . • \ 1 • • · 1 • • • • 1 • i • • I· \ • 1 • • • 1 • · 1· 1 • · \ , • . I. • • • . 'L , • • · • • I : I ". . I. • .. • • · " ' ' I I I I I / I / I ) I I I / I I I I \ 0 I» -CJ" ~er cil !!!. '<0 / I \ 11 I I \\ \ \ 11 \ 11 ' 1 \ I I \ I I I I I I ! 1, I \ /11: '(\It\ , ', I \ I \ I I I I \ \ ~ 111111 / 1 i ) 1 i/ I I / / I I ! I C I II I I I I ! I I II I I I // / I I I I I I ! I I I / I I \ ' I I I I I / I I I I I / ~ I It \1 11 \ I 1 I 11 I I 1 ; I 111 I I / \ I 11 I \ \ .1 \ '-I\,~, I I I \ ! \ I I I \ \ I I I \ \ I I I I I I '\ ,, \' I I I \ r:: I \ r-111/ 1 '\ 'I-I 1, /111 \ \ / I ' / I I , \ I I \ I I I ; : I / / I I I / I I I I I I I I I I I I ) I I I I I I ;I I I / I I I I I I/ / I i \ I I ~ / / I I I I I I I I I I; ' ) / / I I I I / ' / I I 11 I / 1 • I I I \ I I ' I I )\ I I I I I I I I I I II I I [ I \ !1 I I I I I I I I I I I I I 11 I I I / I 11 " 7 I I I I I / I I I I I I I / I I I I I I' // I I ! ! I I I \ \I \ I I / I I I I I 1111/11 \ \! I I I I I I / _ / I I I I I I I / / ' I I I I I I ! I I I I I I I I I I I I I I I I I I I I I I I I I I I I ! I I I I I I I / I Ii I I I I I I I I I I I I / I I' I 11 / I I I I I I ' I I I I I I I I I I I I I I I I I , I I ~ \ \ I / / ( ! I ( / ( I ~ \ I / / ,/ \, I I \ \ I I I \ ,, I I I \ ,\ ( J J ' / I I 1/ \ \ ~ I I I I / / \ I I I ii \ ,\ I \ ;-,, I I -I I I \ ' I I 11 ( I / \\ " t / ,' I I \ \ I I / I ., ·\ • \ ,\ • •• . , • • , \ . I · \ , . I • -------\ ~ .. .. 4 .. \ • t \ 4 b. ... \ 4 ) • .~ • • • I I I \ • •.,,,, ·~,· , " '\ .• . I'. · 1 •, \ • '1• ' I . . • • 'I, • '"'-• • '( '\ ' · \. • ,\ • ' -1 'f ' • I •, \s \" • • • • ' • • •· I,, • . • I • •, • • I •. • 1\ .. t, ~ I ,.. \. \ • I " 1• 1 · I .. -I ~-.. " -\ . • ,r: \ 4. .. i,,. / \ .. ; . \ -' \ / . ~ . . .. ·1 . .. 4 .. 4 ' ',/ . ' , \ . I t ,. . • • • • I I • /" ' ~ I \ • \, /'·. • • • / I,• ' . .--• .. \ .. • I • ./._ ". • / I I L • • / / I ----' • / -.___, 1 / / I 1.i, / I / / I I • / ; I /, ~ I I ' • . • • l " \·-•1. b \" : . ~ \ .. . .. • .. t,.· \ \ .. ~" .. \ ~ I \ \ /\I.• I \ I 1 \I . • I I \ \\\ ,. I \' ,\ ' ·, \ \ I \ \ 1· I I I \ \ I \ .~ . . .I \ \ \ \ \ I "\ \' . I \ I \ \ ! I I \ 1\ \ \ . ' ' . . ' \ I \ \ I I I .1. \; \ \ \ \ \ " 0\ • • I \ 1 1\ 1 \· '\• I \ \ \ \ I \ \ \ \ \ \ \ I I \ I I \ \ \ \ • • I I I I I ( I ~ I I • I I ·1 I I I I\ \ I , I , \ I ·1·· \ I I I\ \ I [ \ \ I \ I I I I I \ 11 ' ' ~, \., "-_,, -~ I \ \ \ I ) / ( I \ \ I I I \ \ -r \ I '-I ( \ I \ \ / f ., ' -• .. /•I . I . • .( .. I . ·, • • ' ' • • .. I _1 7 I • I ., • ' 1"." I>. • ' • • ,, I .. _/ ,· I • "-\ .. I • ·r. I • I ) ~ \ • . . \ ,; \ \ I I \ / b ". /I \ \ I \ \ / • /' ) I \ , ·• I \ \ \ I I / / . / I I• ' I I I I I ' I / I I I • I 11 ~. '1/ ,• I i . I' . J I I \ I \ ( / ,:,.✓ •• / ! ;: .,,/· / / 1_1--+: I I \ . I ..• / // I. I I : ' : : \ . I, I I I \ I • • / I I • I \ (•• I I • / I I I I \' \ \ I , . / ; • . I . • / I \ I I I · I I I , . · \ / 11 · • , I / I I I \.. I \ ," \· / •• / I I / I '•"' \ I I . • • / ' . /' I I I I I I • \c,. .. ~ I \ \,· •·\• \ I • .I · I I \ I •I I I I • I I \,' .• / I ' l . ' I I I I I I I, , ; I I I ; ; • I, . , •! I I I I I I \ \ I I I I I \ \ \ \ \ \ I I / I \ \ I \ \ 7 \ \ \ I \ \ I \ \ '\ ' \ \ I I I \ \ \ \ I '\ \ ! \ ~ I \ I \ 1, I \ \ \ \ \ \ \ \ I I I \ \ \ \ \ \ \ I \ \ I I \ \ \ \ \ \ \ \ I I I I I \ \ \ I I I I I I \ \ \ \ \ \ \ \ I I I I I \ I I \ I \ \ \ \ I I \ \ \ \ \ ' \ \ '\ \ \ \ \ \ \ \ \ \ \ I I I I I I I I I I \ ~1.......,..11 ' 1111 / I , i , ·1 / / ./' , ( \ I I I \ •, I ! I . 7·. / I 11 ~ · '!1----.,..----ll I I I / 1 , ; , ,./ I I I \ , I / ' \ /! • / I / ' , , I I \ I I :• I ; ( ' , I / I /, j ' \ I / I I 1\ II \ I· . I I I I I I \ \ I I I I I I \ \ I ) ' >, / I \ ++/ 11 / / I I \ \ I \ I / I ,\ \ I / I I \ \ I I I \ \ I I I I I \ \ \ \ I I ( I I \ \ ) \ I \\ I , I r '· • • •' • • , I I .•II I•• ; I \ I " "" I I I I I I 4 , I I I • • • I I , I ' I ;\ I I ' I I ' ' / ; !' ,' I ; / / I / / I / / I -/ / ) / / -~ / I I / I I I I I I I I I I I I I \ I ( \. I I I • ,;/' ./ / ;I' • • / / I / ~.. \ I I ! ✓ ' ) J I I I I I I/ .. I; I I \ • . . .'. I • / I • I•·• / / \1 .I/ I , • 1,,, /, 1 1 'b _r,. .._,_ __ _,___....1----'-'' : I / I ' • / / /\ I / I / / I / -/ / I I \ / I I I 1, \I I ( I ) I ) ✓------I .... ,. I o.-I " " . I · ' /' ' ,,. · ·•· ;;, · • ,,, • 7 , . I .. _ ... I . • / .. -... -I "·/ I • . ,,_,"' • . • ,,,-,, • , / ; / ; '! ' /·' •• / • / '' / 1 . .I'· •• I• ,'/ I' •"i ;• ,,------• .... ,,. ; \/ • 1•" .. _/ .. t,. ,. b._l 4 bf ·";··· ·7. --;'. /' :~,>· . ,· /. // // ' \ • / • • J ' • '/ . . !' I' I • , • /;: . ' • / / / \ / 4 / 4 / 4 j .• 0 I I . A I b. ,;{i,. t,. / .... . " 4 / / / ; • I ' b ' •; / • / . . . ' ' . . . . . . // ( ' . / / "·. I •• I • •. • • I .• • . . ' / I • 7 , . t . /· ... 1 • (. 1 1 , ·. , •' I,,· • , --✓ , , / // \ • I l • ·1 • I • I b j' • • .. ' f " I • ( • • ' / / / \ I • ; • • • • -I ... • • I .. .✓. • • ' I • ! ( • I • • • ·I • / I \ ,• ' •I I • • • I • I • , I ' '. I . ' . ! I. I / , i.. • ·1 • • r . i • . i.. • i • , •. ,., • .1 / ,,,, ~" ........ ,· ,•.•· ;• /, ) .. -.... ; .. I t,. t,. ·I ... r / / ' I J ----r--f----+-----f--~--✓__::_.-__ / / I / / // / /, -+--If--_; -,--, ,,. I )__ \ I J I I I )----r----r--1---!,------;L-_L __ ,::-,.._ I !/ ( , , I / : \ \ ( 111 i ( / I v1 I )\ I ~ .. \ / I / ,,j j \ I I I / ,/ / \ \ V / / I / I I I I / / / / ,.-I / / / / / / / / I / / -/ / / -I I I I I I / I I / I / '; / / ,.-/ I I / / / / / / / / / I / I / ,.-r ~ / I ( / \ / / / / --~/ / / / / I ,,.--~ ( ) / I I \;'I// J I / I .,-----( ' ' / v ( \ :::.. \ / / I \ -:~ I e---I I I ~--~ I ~ I ( ) I I I \ \ I / I I I I ' \ / ( f / ( / / \ I I ( I I I I / / I I I I I I _-r_ -' I \ I I :... I / -1 I I I I / \ / I I I I -\~ I I \ I ( \ \ \ T I I I I '\ I I I I ( I I I \ \ " \ '--" \ I I '--'---~ I \' \ ,, ,, 0 g :E -----C. a:, ---- >>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>> >>xxxxxxxxxx xxxxxxx57 8 0 5760 5770 5790 5800 5784 5776 5794 5760 5770 5750 5790 5792 57 9 0 5798 R20' PROPERTY LINE PROPERTY LINE PROPERTY LINE C1 C2 C3 C4-2.1:1-2.0:1-2.0:1-2.0:1-2.0:1-2.6:10.9% 1.1% 1.0% 1.1% 1.0% 1.0%1.0%1.6% 1.7%1.1%FFE:5765.83' FFE:5766.46' FFE:5773.45' FFE:5773.95' FFE:5774.45' FFE:5774.95' FFE:5774.45' FFE:5773.95' FFE:5773.45' FFE:5772.95' FFE:5770.16' FFE:5769.67' FFE:5769.16'FFE:5768.66' FFE:5768.16' FFE:5768.26' FFE:5768.76' FFE:5769.26' FFE:5769.76' FFE:5770.26' FFE:5767.76' FFE:5768.26' FFE:5768.76' FFE:5769.26' FFE:5769.76' FFE:5770.26' C5 -2.8:1-2.8:1-2.6:1-2.3:16.5%57 8 0 57745770 5760 5760577057681.0% RIM:5771.26' RIM:5773.06' RIM:5774.33' RIM:5774.26' RIM:5770.73' RIM:5770.34' RIM:5769.15' RIM:5768.35' RIM:5767.80' RIM:5768.55' RIM:5769.44' RIM:5770.37' FFE:5770.76' FFE:5770.76' FFE:5770.66' FFE:5771.16' 2.9% 5800 5790 5780 5770 57 7 0 5780 5790 5800 5770 5780 5790 5800 5770576857705770 5766 5762 5762 5766 577457 7 8 57765776 5770 5766 5762 5764 5770 5766 5762 5758 5756 5754 5752 5750 5748 5746 RIM:5770.81' 1.0% 2.1% 1.0% 2.9%0.0%1.0%1.0%1.0%0.9%1.7%1.0%1.0%1.0% 1.0%1.0%2.1%1.0%1.0% 1.0% 6.6% 5.3%1.0%2.1% 1.0%1.0%1.0%HWY 6 I-70 I-70 EMPTY FIBER CONDUITS oe OPRIS ES NGINEERING, LLC. CIVIL CONSULTANTS 19137.01JOB NO. DATE:04-15-22 502 MAIN STREET CARBONDALE, CO 81623 (970) 704-0311 FAX: (970)-704-0313 DESIGNED BY DRAWN BY CHECKED BY AD 01/28/22 AD 01/28/22 YN 04/15/22 DATE REVISION C-3.3 DRAWING NO. TITLE G:\2019\19137\CIVIL\CIVIL DWGS\PLOT\LIMITED IMPACT REVIEW\19137 C3.0 GRADING.DWG - Mar 30, 2022 - 9:35pmNORTHGRADING & EROSION CONTROL PLANROYAL MINI STORAGE AT CANYON TERRACESGARFIELD COUNTY, COLORADOLIMITED IMPACT REVIEW1 inch = ft. ( IN FEET ) GRAPHIC SCALE 020 20 40 20 8010 MEMBER UTILITIES FOR THE MARKING OF UNDERGROUND BEFORE YOU DIG, GRADE, OR EXCAVATE CALL 2-BUSINESS DAYS IN ADVANCE .QRZZKDW V 5 SHT C2.1 SHT C2.4 SHT C2.2 DAYLIGHT: 5745.3' ± INV: 5776.76' 12" ADS N-12 SECURITY GATE INV IN: 5761.37'170LF OF 60" ADS N-12 SMOOTHED WALL PIPE @ 9.29%d . .,. 4 . ---- d • • • d , ~-'--""'-... • • ---------E ,. \ \ I 7' I ,,..,..------- ------ • • \ \ \ - - -----~ . • --- • • • --------------- -- \_ / / ./ / I • • /4--"- --------- / / -- • I ~ ----------- ----- / / I . . I / f • ~ :----- • I I I --- I / I I / \ \ I I \ / ,-/ \ \ \ \ \ \ \ . \ I \ 11 \ \ \ / I \~ • I / / \ I I \ \ \ / / \ \ I \ --------✓ ,-/ ~ ------,,.,--- ---- / / \ I I \ \ \ I .J I \ \ \ \_ • / / / I I \ \ -- ) I / \ I ~ r '---- '---- - ----- / I / / _-;, I -------f--~ I I ~ I I / I I I I I / I I • - I d I • • \ \ ' 0 rr,r, / / " / ---·.-· ' ------/ - - -/ / ., ✓:;; • I ' / • '7. L-----...;'....----------J------.-...: ... --------.1-----.. -------------.l-----,,..11----...... ---:..-.,,.---J.--..:>---J /4. ., • /'-,,~. d •• ~ .:. •• ,~ ---• • • ·, / ... ,F··· ~/d,.,,.,,-~ "/ I • ' I ' ' • ' •/ " ' ' / • 0 ' • •, " ' -• o • --•' ' ' --•-• •·. d / • ja / ,/ -/ . -~ '. ' -" . ' ' ' .. / ' /·'. ,__;a. .. -,->•c.--• __________ .;...;--/"';_....a;:;...;,-,c;"--..:----..,;-c..-'""'""------,._ ___ ..:-------------..:"'-~---·•---.-'---/ -_.-ca-. c'--c ~ ./ . ' -. -_. a .• -" -' . / .r . -=-.-----""-"'" -__ .__._...;_-11-- 1 ,, ' • -' ' ' ' ' •-' • / • / ' I "'· . '-._ • ' -· ;" ,. .:1/ "'" / ,:37 ' ' • ' < • -•,-' ', -~ / ' . • . "" " '-~---' .-,· - / --.,, --/ / i • • • I • • d / / • ) / / ------------ C below all before you·d. 19. xxxx5780575 0 57 3 057605770 5790 EXISTING LEECH FIELD EXISTING WELL EXISTING PROPANE TANK PROPERT Y L I N E OUTDOOR STORAGE-2.2:1-2.0:1-2.1:1-2.3:1-1.9:1-2.6:1 5762 5764 5780 5770 577057805750 5760 5 7 6 0 5 7 5 0 5784 5782 -2.3:1-1.9:1-2.0:11.0%2.0%2.0% 2.6% 1 0 . 2 % 10.4 %5.0%0.7%2.0%3.2% 1.5% 1.0% TOW:5778.93' TOW:5787.47' TOW:5789.46' TOW:5799.48' BOW:5794.48' BOW:5783.98' BOW:5780.77' BOW:5778.47' FFE:5782.50' HWY 6 I-70 I-70 EMPTY FIBER CONDUITS WALL PROFILE 5770 5780 5790 5800 5770 5780 5790 5800 0+00 0+255782.05787.480+505784.05789.480+755792.05799.480+81 5794.0 5799.48 OPRIS ES NGINEERING, LLC. CIVIL CONSULTANTS 19137.01JOB NO. DATE:04-15-22 502 MAIN STREET CARBONDALE, CO 81623 (970) 704-0311 FAX: (970)-704-0313 DESIGNED BY DRAWN BY CHECKED BY AD 01/28/22 AD 01/28/22 YN 04/15/22 DATE REVISION C-3.4 DRAWING NO. TITLE G:\2019\19137\CIVIL\CIVIL DWGS\PLOT\LIMITED IMPACT REVIEW\19137 C3.0 GRADING.DWG - Mar 30, 2022 - 9:40pmNORTHGRADING AND EROSION CONTROL PLANROYAL MINI STORAGE AT CANYON TERRACESGARFIELD COUNTY, COLORADOLIMITED IMPACT REVIEW1 inch = ft. ( IN FEET ) GRAPHIC SCALE 020 20 40 20 8010 MEMBER UTILITIES FOR THE MARKING OF UNDERGROUND BEFORE YOU DIG, GRADE, OR EXCAVATE CALL 2-BUSINESS DAYS IN ADVANCE .QRZZKDW V 5 SHT C2.3 SHT C2.1 SHT C2.2 30% SLOPE LINE WALL PROFILE SCALE VERTICAL: 1" = 20' HORIZONTAL: 1" = 20' PROPOSED GABION WALL FOR ROCKFALL MITIGATION EXISTING HOME TOP OF WALLBOTTOM OF WALL EXISTING CONDITIONS TOP OF WALL BOTTOM OF WALL / I /1 I / / / / / I I 11 I I I I / I I I / / / / / / / / / / I I I / / / \ / I / / I I \ \ \ ( / / ( I I I I I I ) / / / / / / / / / / / / / / / / / / / / / / / / / I I I / ( / / / / / / I I I / ( / I I I I I / / I I / / ( / / I I / / I I I / / / I I / / / I I / I I I \ ------/ ~ ~ \ I / \ \ \ \ \ / I / _-/ / _,,---/ -------------/ / 0 0 0 0 Q Q Q Q 0 0 0 Q Q Q Q Q / / 0 0 0 0 Q Q Q Q 0 0 ~ 0 c:: Q c:: Q / / / -- / / -/ --/ -/ / / / / / / / -/ / / / / / / / / / / / / -----" -'\ \ \ \ \ \ ) / / / / / / / / / ---/ / \ I ( I I I \ I I I \ I I I I I I I I I I I I I I I I ,,. I I I I I I I ; I I / l I \ I \ \ II \ // II I I / I / / / / / / / / / -/ I I I I / '- " "\ \ \ ( • rur, , _-/ \ \ ---- below. Call before you dig. ue ue ueueu e ue ue ue ue ue ue ue ue ueueueueueoe oe oe oe oe oe oe oe oeoe8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL 8''WL 8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL2''WL 2''WL 2''WL 2''WL8''WL 8''WL 8''WL8''WLUEUExxxxxxxxUEUEUEUEA1 A2 A3 A4 A5 A6 A7 OUTDOOR STORAGE EXISTING LEECH FIELD EXISTING WELL SERVING EXISTING HOME PROPERT Y L I N E PROPERTY LINE PROPERTY LINE PROPERTY LINE PROPERTY LINE PROPERTY LINEC1 C2 C3 C4 OUTDOOR STORAGE EMPLOYEE HOUSING OFFICE EXISTING HOME WESTBOUND INTERSTATE 70 HIGHWAY 6&24 EXISTING DIRT ROAD C5 B1 B2 B3 B4 B5 B6 B7 B8C2.1EXISTING OVERHEAD ELECTRIC PROPOSED 8" WATERMAIN FROM TANK EXISTING UNDERGROUND ELECTRIC NEW LOCATION OF UNDERGROUND ELECTRIC PROPOSED FIRE HYDRANT EXISTING DRY HYDRANT EXISTING ELECTRICAL TRANSFORMER EXISTING PROPANE TANK PROPOSED GABION WALL PROPOSED OWTS EXISTING DRIVEWAY REDUCER TO 2" WATER LINE OPRIS ES NGINEERING, LLC. CIVIL CONSULTANTS 19137.01JOB NO. DATE: 502 MAIN STREET CARBONDALE, CO 81623 (970) 704-0311 FAX: (970)-704-0313 DESIGNED BY DRAWN BY CHECKED BY AD AD YN DATE REVISION C-4.0 DRAWING NO. TITLE G:\2019\19137\CIVIL\CIVIL DWGS\PLOT\LIMITED IMPACT REVIEW\19137 C4.0 UTILITY PLAN.DWG - Mar 31, 2022 - 9:02amNORTHUTILITY PLANROYAL MINI STORAGE AT CANYON TERRACESGARFIELD COUNTY, COLORADOLIMITED IMPACT REVIEW1 inch = ft. ( IN FEET ) GRAPHIC SCALE 075 75 150 75 30037.5 MEMBER UTILITIES FOR THE MARKING OF UNDERGROUND BEFORE YOU DIG, GRADE, OR EXCAVATE CALL 2-BUSINESS DAYS IN ADVANCE .QRZZKDW V 5 04-15-22 02/11/22 02/11/22 04/15/22 PROPOSED WATER TANK 180,000 GALLONS EXISTING WELL TO FILL TANK EXISTING WELL TO SERVE EMPLOYEE HOUSING UNIT WATER SERVICE TO EMPLOYEE HOUSING UNIT PROPOSED FIRE HYDRANT PROPOSED FIRE HYDRANT PROPOSED FIRE HYDRANT I \ \ \ \ '\ \ \ j ~:...-:--------=::.:----------------==--1-------==------------==---L------'~ _____________ _::.:c=======~======1 I 1 \ \ • • C below all before you· dig. 4''SS4''SS4''SS4''SS4''SS4''SSsasvcsasvcsasvcsasvcsasvcsa svc4''SSue ue ue ue ue ue ue ue ueueue ueueueue ue ueueueueueueueueueueoe oe xx8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WLUEUEUEUEUEUEUEUEUEUEUE xxxxxxxxxxxx xUEUEUEUEUEUEUEUEUEUEUEUEUEUEUEINSTALL 1000 GALLON 2-COMPARTMENT CONCRETE SEPTIC TANK (USE VALLEY PRECAST ITEM # IM 1000-2CP) W/ SEALED RISERS AND LIDS INSTALLED AT THE FINISHED GRADE SURFACE. INSTALL INLET SANITARY TEE AND OUTLET EFFLUENT FILTER SANITARY TEE. DEPTH TO TOP OF TANK FROM PROPOSED GRADE IS APPROXIMATELY 18". EXCAVATION DEPTH 1' MIN.-4' MAX. BELOW SURFACE GRADE MINIMUM. 12" COVER OVER TOP OF CHAMBERS FILL & GRADE FIELD AREA APPROXIMATELY 3"-6" ABOVE EXISTING SURFACE GRADES 4" PVC DISTRIBUTION PIPES (TYP.) 4" PVC EFFLUENT PIPE @ MIN. 1 %, USE SCHD-40 0R SDR-35 ABSORPTION/TREATMENT FIELD USE 44 QUICK-4 CHAMBERS IN 4 TRENCHES WITH 11 CHAMBERS PER ROW FOR A TOTAL ABSORPTION AREA OF 528 S.F. THE SYSTEM SHALL BE PLUMBED FOR EQUAL GRAVITY DISTRIBUTION. THE CHAMBERS SHALL BE INSTALLED ON LEVEL GRADE IN EACH TRENCH. THE BOTTOM OF EACH TRENCH TO BE EXCAVATED TO A MAXIMUM AVERAGE DEPTH OF 36 INCHES BELOW THE EXISTING SURFACE GRADES, WITHIN THE UPPER HORIZON OF THE NATIVE SANDY SILT LOAM SOILS & BACKFILLED WITH A MINIMUM 12-INCHES OF COVER OVER THE CHAMBERS. THE FINISH GRADE ACROSS THE FIELD SHALL BE SLIGHTLY MOUNDED A MINIMUM 6-INCHES ABOVE EXISTING ADJACENT GRADES. CONCRETE DISTRIBUTION BOX WITH BAFFLE INSTALLED LEVEL ON COMPACTED BASE INSTALL RISERS AND LID TO SURFACE 4" PVC SEWER PIPE @ 2%, USE SCHD-40 0R SDR-26 INSTALL 4" RISER PIPE INSPECTION PORT EXTEND RISER W/ PUSH ON CAP MIN. 4" BELOW FINISH GRADE & COVER WITH 6" DIA. VALVE BOX SET WITH LID 1" ABOVE FINSH GRADE (TYP. EACH TRENCH CHAMBER END CAP) INSTALL CHAMBER END CAP ON ALL END CHAMBERS PPROPOSED SOIL PROFILE PIT 4" TWO-WAY CLEANOUT UNDERGROUND ELECTRICAL LINE TO BE MOVED TO ALLOW FOR ABSORPTION FIELD PLACEMENT A1 A2 A3 EMPLOYEE HOUSING UNIT OFFICE BUILDING CARPORT C4 C5 DEBRIS BASIN 2 OPRIS ES NGINEERING, LLC. CIVIL CONSULTANTS 19137.01JOB NO. DATE:04-15-22 502 MAIN STREET CARBONDALE, CO 81623 (970) 704-0311 FAX: (970)-704-0313 DESIGNED BY DRAWN BY CHECKED BY PR 01/17/22 PR YN 04/15/22 DATE REVISION C-4.1 DRAWING NO. TITLE G:\2019\19137\CIVIL\CIVIL DWGS\PLOT\LIMITED IMPACT REVIEW\19137 OWTS DESIGN.DWG - Mar 30, 2022 - 8:35pmNORTHOWTS PLAN 1 inch = ft. ( IN FEET ) GRAPHIC SCALE 020 20 40 20 8010 MEMBER UTILITIES FOR THE MARKING OF UNDERGROUND BEFORE YOU DIG, GRADE, OR EXCAVATE CALL 2-BUSINESS DAYS IN ADVANCE .QRZZKDW V 5 01/17/22 ROYAL MINI STORAGE AT CANYON TERRACESGARFIELD COUNTY, COLORADOLIMITED IMPACT REVIEW==.• ... =.==.=•-~===··.===.S-""'•=""====~-===·.====-~==J..----------------.-.1---.----~.---------1.---------1-..,.---.,..---J------"""'·,...---.. ---,,----.-1 , , ' , , , ' , • • • . • , • • •• • • , • • ~ . . • • • • , • • • • d • • • • A ' , • • cl • ~ d ' • • , • • , • • d .,, • • • • • • • , • / ... • • , • . • •-'-""I"" • .., ,4 £1 __. • 4 .. ----- • A • • , \ • •· , • • ., • ' • , • • • • A Li;, • .....,____ •• ~ • • • • •• • • • , . • • • • • • .. , . , I \ I \ • • ------------ • . . , ff. • • • d • ,. • .. d . • • d • • . ., • • , . • • • \ • • • , • d .. • • , . • ., '° • • • ,• .• • . • • ,· • •· • . . • • • • • • • • ,j • d •• • • A • ,, • • • • . . • . •• : , • • d • , • • • • • . • . .., • . • , • • ' . , • • • . • , .. • . • <' , . ,. • • • • ~ , • • -, • d ~., • ~ ___._ • , • . . -, • ..... . • . . , • • • • • • • • .-• A , • .-.. , 1 • I • • • • --------------------- -------■----------------------1---------------------------------A". 4' C below all before you· d' 19. Subsoil Study Kumar & Associates, Inc. 5020 County Road 154 Glenwood Springs, CO 81601 phone: (970) 945-7988 fax: (970) 945-8454 email: kaglenwood@kumarusa.com www.kumarusa.com Office Locations: Denver (HQ), Parker, Colorado Springs, Fort Collins, Glenwood Springs, and Summit County, Colorado August 20, 2019 MMME-WG, LLC Attn: Mark Gould P.O. Box 130 Glenwood Springs, CO 81602 (mark@gouldconstruction.com) Project No.19-7-437 Subject: Subsoil Study, Proposed Commercial Development, Highway :HVWRI$PL¶V Acres, Garfield County, Colorado Gentlemen: As requested, Kumar & Associates, Inc. performed a subsoil study at the subject site. The study was conducted in accordance with our agreement for geotechnical engineering services to MMME-WG, LLC dated July 15, 2019. A field exploration program consisting of exploratory borings was conducted to obtain information on the subsurface conditions. Samples of the subsoils obtained during the field exploration were tested in the laboratory to determine their classification, compressibility or swell and other engineering characteristics. The results of the field exploration and laboratory testing are presented in this report. Site Conditions: The subject site was mostly vacant at the time of our field exploration. A modular house is in the west part of the property and a small shed is in the east part north of the former driving range. The topography is undulating alluvial fan deposits. The terrain is moderately to strongly sloping down to the south. A large drainage channel is to the east of the house and other smaller channels cross the central area of the property. A rainstorm caused a debris flood/flow in these channels at the time of our field exploration on July 26, 2019. Siltstone/sandstone bedrock is visible in outcrops on the north valley side above the property. Vegetation consists of grass, weeds and brush with scattered gamble oak and juniper. Field Exploration: The field exploration for the project was conducted on July 26 and 29, 2019. Three exploratory borings were drilled at the locations shown on Figure 1 to evaluate the subsurface conditions. The borings were advanced with 4-inch diameter continuous flight augers powered by a truck-mounted CME 45B drill rig. The borings were logged by a representative of Kumar & Associates, Inc. I( A Kumar & Associates , Inc .® + Geotechnical and Materials Engineers and Environmental Sc ient ists An Employee Owned Company -2 - Samples of the subsoils were taken with 1 ¾ inch and 2-inch I.D. spoon samplers: The samplers were driven into the subsoils at various depths with blows from a 140-pound hammer falling 30 inches. This test is similar to the standard penetration test described by ASTM Method D-1586. The penetration resistance values are an indication of the relative density or consistency of the subsoils. Depths at which the samples were taken, and the penetration resistance values are shown on the Logs of Exploratory Borings, Figure 2. The samples were returned to our laboratory for review by the project engineer and testing. Subsurface Conditions: Graphic logs of the subsurface conditions encountered at the site are shown on Figure 2. The subsoils consist of a minor topsoil depth overlying medium dense, silty sand and gravel with cobbles and probable scattered boulders to the maximum explored depth of 26 feet. Boring 3 encountered more rocky soil below a depth of about 14 feet. Laboratory testing performed on samples obtained from the borings included natural moisture content and density and gradation analyses. Results of swell-consolidation testing performed on a relatively undisturbed drive sample of the finer soil, presented on Figure 4, indicate low to moderate compressibility under conditions ofloading and wetting. Results of gradation analyses performed on small diameter drive samples (minus 1 ½-inch fraction) of the sand and gravel soils are shown on Figure 5. The laboratory testing is summarized in Table 1. No free water was encountered in the borings at the time of drilling and the subsoils were slightly moist to moist. If you have any questions or ifwe can be of further assistance, please let us know. Respectfully Submitted, Kumar & Associates, Inc. Steven L. Pawlak, . SLP/ljf Attachments" Figure 1 -rfli@!W~ ory Borings Kumar & Associates, Inc. ® Figure 2 -Logs of Exploratory Borings Figure 3 -Legend and Notes Figure 4 -Swell-Consolidation Test Results Figure 5 -Gradation Test Results Table 1 -Summary of Laboratory Test Results Project No. 19-7-437 Kumar & Associates-I --150 0 150 300 ·~ n OJ. ,_ .. ~ APPROXIMATE SCALE-FEET 00--------------------------------------ii 19-7-437 r~...._ ____ ......_ __________ ....._ _________________ ,__ __ __ LOCATION OF EXPLORATORY BORINGS Fig. 1 i ,.; 0 ] .il [" ;1 N,._ 0.1, ,_ .,-;;; I-w w LL.. I :::r: I-a. w 0 0 5 10 15 20 25 30 BORING 1 EL. 104' 18/12 18/12 10/12 50/5 25/12 50/3 BORING 2 EL. 110' 22/12 14/12 8/12 17/12 23/12 30/12 BORING 3 EL. 93' 13/12 12/12 22/12 60/12 50/1 50/0 0 5 10 I-w w LL.. 15 I :::r: I-a. w 0 20 25 30 ~~-------...... -------------,...------------------------,...-----IOi ;f 19-7-437 , .. i~------------------------------------------------Kumar & Associates LOGS OF EXPLORATORY BORINGS Fig. 2 1 til e,._ (1 N,._ 0.1, ,_ °'" LEGEND I TOPSOIL. ~ ~ p DRIVE SAMPLE, 2-INCH I.D. CALIFORNIA LINER SAMPLE. ~ DRIVE SAMPLE, 1 3/8-INCH I.D. SPLIT SPOON STANDARD PENETRATION TEST. 18;12 DRIVE SAMPLE BLOW COUNT. INDICATES THAT 18 BLOWS OF A 140-POUND HAMMER FALLING 30 INCHES WERE REQUIRED TO DRIVE THE SAMPLER 12 INCHES. NOTES 1. THE EXPLORATORY BORINGS WERE DRILLED ON JULY 26, 2019 WITH A 4-INCH-DIAMETER CONTINUOUS-FLIGHT POWER AUGER. 2. THE LOCATIONS OF THE EXPLORATORY BORINGS WERE MEASURED APPROXIMATELY BY PACING FROM FEATURES SHOWN ON THE SITE PLAN PROVIDED. 3. THE ELEVATIONS OF THE EXPLORATORY BORINGS WERE OBTAINED BY INTERPOLATION BETWEEN CONTOURS ON THE SITE PLAN PROVIDED. 4. THE EXPLORATORY BORING LOCATIONS AND ELEVATIONS SHOULD BE CONSIDERED ACCURATE ONLY TO THE DEGREE IMPLIED BY THE METHOD USED. 5. THE LINES BETWEEN MATERIALS SHOWN ON THE EXPLORATORY BORING LOGS REPRESENT THE APPROXIMATE BOUNDARIES BETWEEN MATERIAL TYPES AND THE TRANSITIONS MAY BE GRADUAL. 6. GROUNDWATER LEVELS SHOWN ON THE LOGS WERE MEASURED AT THE TIME AND UNDER CONDITIONS INDICATED. FLUCTUATIONS IN THE WATER LEVEL MAY OCCUR WITH TIME. • GROUNDWATER WAS NOT ENCOUNTERED IN THE BORINGS AT THE TIME OF DRILLING OR WHEN CHECKED # DAYS LATER. 7. LABORATORY TEST RESULTS: WC = WATER CONTENT (%) (ASTM D2216); DD = DRY DENSITY (pct) (ASTM D221 6); +4 = PERCENTAGE RETAINED ON NO. 4 SIEVE (ASTM D6913); -200= PERCENTAGE PASSING NO. 200 SIEVE (ASTM D1140). ~~1--------------------.--------------------------1 gf 1;f 19-7-437 , .. !~-----------------------------------------Kumar & Associates LEGEND AND NOTES Fig. 3 ~ ~ E c'.l l SAMPLE OF: Silty Sand and Gravel with Cobbles FROM: Boring 1 @ 5' WC = 10.7 %, DD = 110 pcf 1 ADDITIONAL COMPRESSION v-UNDER CONSTANT PRESSURE -----~ -DUE TO WETTING --,--.,. 0 ----~ -r---7< ......., --c--...J -1 ...J ~ l.&J 3: ~ V) I -2 )t z 0 ~ <( 0 -3 ::J 0 V) z 0 (.) -4 These test results opply only to the samples tested. The testing report sholl not be reproduced, except in full, without the written opprovol of Kumor ond Associates, Inc. Swell Consolidation testing performed in occordonce with ASTM 0-4546 . • 1 1.0 APPLIED PRESSURE -KSF 10 19-7-437 Kumar & Associates SWELL-CONSOLIDATION TEST RESULTS 100 Fig. 4 HYDROMETER ANALYSIS SIEVE ANALYSIS TIME READINGS Joo U.S. STANDARD SERIES CL.EAR SQUARE OPENINGS j_ 2, HRS 7 HRS 100 ~-.. , .. ,. .. , .. 60MIN 19MIN 4MIN 1MIN '"100 .a50 .a,o .a30 '"16 '"10 8 .. 3 8" 3 ... 1 112· 3• 5•5• 0 90 10 80 20 70 30 --li! 60 -40 I ~ I I 50 I 50 ; I g I ~ 40 60 30 70 20 80 10 90 0 100 .001 .002 .005 .009 .019 .037 .075 .150 .300 I .600 1.18 I 2.36 4.75 9.5 19 38.1 76.2 127 200 I .425 2.0 152 I DIAMETER OF PARTICLES IN MILLIMETERS SAND GRAVEL : COBBLES CLAY TO SILT FINE MEDIUM COARSE FINE COARSE GRAVEL 19 % SAND 37 % SILT AND CLAY 44 % LIQUID LIMIT PLASTICITY INDEX SAMPLE OF: Silty Sand and Gravel with Cobbles FROM: Boring 2 0 15' HYDROMETER ANALYSIS SIEVE ANALYSIS TIME READINGS U.S. STANDARD SERIES CLEAR SQUARE OPENINGS 24 HRS 7 HRS . 1 1/2" . 145 MIN 15 MIN 60MIN 19MIN 4MIN 1MIN .a•= •100 .. ,~n ••o .. tn • 6 .a,n 18 4 . 3 4• s•5• , • 0 100 I I I 90 I 10 I I I 80 I 20 I I I I 70 30 ---60 -40 I 50 50 I !ii !ii i 40 60 i 30 70 20 80 10 90 0 100 .001 .002 .005 .009 .019 .037 .075 .150 .300 I .600 1.18 I 2.36 4.75 9.5 19 38.1 76.2 127 200 I .425 2.0 152 I DIAMETER OF PARTICLES IN MILLIMETERS SAND GRAVEL I COBBLES CLAY TO SILT FINE MEDIUM COARSE FINE COARSE GRAVEL 38 % SAND 36 % SILT AND CLAY 26 % LIQUID LIMIT PLASTICITY INDEX These lest results apply only lo the SAMPLE OF: SIity Sand and Gravel with FROM: Boring 2 0 20' samples which were tested. The testing report shall not be reproduced, Cobbles except In full, without the written approval of Kumar & Associates, Inc. Sieve analysis testing Is performed In accordance with ASTM D6913, ASTM D7928, ASTM C136 and/or ASTM D1140. 19-7-437 Kumar & Associates GRADATION TEST RESULTS Fig. 5 TABLE 1 SUMMARY OF LABORATORY TEST RESULTS Project No. 19-7-437 SAMPLE LOCATION NATURAL MOISTURE CONTENT NATURAL DRY DENSITY GRADATION PERCENT PASSING NO. 200 SIEVE ATTERBERG LIMITS UNCONFINED COMPRESSIVE STRENGTH SOIL TYPE BORING DEPTH GRAVEL SAND LIQUID LIMIT PLASTIC INDEX (%) (%) (ft) (%) (pcf) (%) (%) (psf) 1 5 10.7 110 Silty Sand with Gravel 10 5.3 109 27 Silty Sand with Gravel 15 3.8 39 Silty Sand and Gravel 2 5 7.5 111 39 Silty Sand with Gravel 15 4.0 19 37 44 Very Silty Sand with Gravel 20 3.6 38 36 26 Silty Sand and Gravel 3 2½ 3.4 98 49 Very Silty Sand with Gravel 5 3.9 94 42 Very Silty Sandy Gravel 15 4.5 93 38 Silty Sand with Gravel I I( A Kumar & Associates , Inc .® + Geotechnical and Materials Engineers and Environmental Scientists I I I I I I I I I I I I Rockfall Evaluation and Mitigation Study RJ Engineering FINAL ROCKFALL EVALUATION AND MITIGATION STUDY DEVER SUBDIVISION EXEMPTION PARCELS A AND B GLENWOOD SPRINGS, COLORADO March 23, 2022 Prepared By: Prepared For: Mr. Mark Gould Gould Construction, Inc. PO Box 130 Glenwood Springs, CO 81602 Project No. 19-046G-H1 Rockfall Hazard Evaluation Dever Subdivision Project No. 19-046G-H1 Glenwood Springs, Colorado i TABLE OF CONTENTS 1.0 PROJECT INFORMATION .................................................................................. 1 1.1 Purpose and Scope .................................................................................. 1 1.2 Site Conditions ......................................................................................... 1 1.3 Site Geology ............................................................................................ 1 2.0 ROCKFALL HAZARD EVALUATION ................................................................... 2 2.1 Rockfall Modeling ..................................................................................... 4 3.0 ANALYSIS SUMMARY ........................................................................................ 5 4.0 MITIGATION OPTIONS ....................................................................................... 5 4.1 Barriers and Attenuators .......................................................................... 5 4.2 Scaling ..................................................................................................... 6 4.3 Rock Bolting ............................................................................................. 6 5.0 SUMMARY OF RECOMMENDATIONS ............................................................... 7 6.0 LIMITATIONS ...................................................................................................... 7 Rockfall Hazard Evaluation Dever Subdivision Project No. 19-046G-H1 Glenwood Springs, Colorado 1.0 PROJECT INFORMATION 1.1 Purpose and Scope This report presents a rockfall evaluation and mitigation study for the rockfall potential at the Dever Subdivision, Parcels A and B in Glenwood Springs, Colorado. This study was prepared to assist the owner in determining potential rockfall mitigation options for development of this site. The investigation consisted of field reconnaissance and rockfall modeling. 1.2 Site Conditions The subject site consists of the Dever Subdivision Exemption, Parcels A and B located in west Glenwood Springs, Colorado (Figure 1). The project area consists of natural slopes and bedrock outcrops. The slopes throughout the site vary with grades of nearly level to vertical at the cliffs. The natural slopes between the cliffs and the flatter portions of the site are generally covered with colluvial material and natural vegetation such as bushes and grasses. Figure 1 depicts the approximate locations of features at the project site on an image from Google Earth©. Figure 1 - Approximate Site Location and Project Features 1.3 Site Geology Based on review of the Geologic Map of the Storm King Mountain Quadrangle, Garfield County, Colorado by Bruce Bryant et al., US Geological Survey, Miscellaneous Field Studies Map Series Rockfall Hazard Evaluation Dever Subdivision Project No. 19-046G-H1 Glenwood Springs, Colorado MF-2389, 2002, scale 1:24,000, a majority of the site is mapped as younger fan alluvium and debris flow deposits (map symbol Qfy). The deposits consist of pebble to boulder size material in a sand, silt and clay matrix depending on location. The bedrock cliffs located above the site consist of the Maroon Formation. The Maroon Formation consists of reddish-brown sandstone, conglomerate, mudstone, siltstone and claystone. The mapping indicates the bedding planes dip into the slope (west) at 10 to 20 degrees. Similar bedding inclinations were observed during the site visit. 2.0 ROCKFALL HAZARD EVALUATION RJ Engineering conducted site visits to observe and photograph the conditions at the site. Based on our site visits, we determined that the western section of the site is susceptible rockfall events. The natural cliffs are source areas for rockfall events. The rock cliffs exhibit fractures and discontinuities that are consistent with the potential to generate rockfall (Figure 2). Based on these observations, we believe this section of the site has a moderate to high potential for rockfall events and rockfall mitigation should be performed for improvements planned in this area (see Sheet 1). For other areas of the site, we believe the rockfall hazard is low and mitigation is not required for improvements in other areas of the site. Figure 2 – Typical rock outcrop facing exhibiting potential for rockfall II Rockfall Hazard Evaluation Dever Subdivision Project No. 19-046G-H1 Glenwood Springs, Colorado Due to the very steep terrain and the potential for initiating a rockfall event, we observed the source area from a distance. Figure 3 presents the natural cliffs (source area) located in the west section of the site. The photo was taken looking northwest. Figure 3 – Natural cliffs (Source Area) at site We took field measurements using hand help laser range finding equipment to create slope profiles for rockfall modelling. Based on our measurements and field observations, the source areas suggest there are significant rockfall potential with boulders of up to 5 to 6 feet in diameter. Field observations suggest that a significant amount of rockfall events with rock sizes of 3 feet in diameter were more common. Figures 4 and 5 depict rocks that were presumed to be from rockfall events. Figures 4 and 5 – Rocks on slopes below source area Rockfall Hazard Evaluation Dever Subdivision Project No. 19-046G-H1 Glenwood Springs, Colorado 2.1 Rockfall Modeling Three rockfall pathway chutes were selected for analysis using the RocFall program version 2019 by Rocscience. RocFall is a computer program developed to model a single rockfall event and determine rockfall energies and bounce heights based on inputs such as: slope profile, rock diameter, surface roughness, tangential coefficients, and normal coefficients. RocFall model profiles were selected because they appeared to approximate the pathways that rockfall could roll down the site to the areas planned for improvements. For each pathway, an analysis was performed for 2x3x1.5-foot and 5x6x2-foot boulders. The boulder dimensions were based on observations at the site. Analyses were performed for boulders originating from the top of the cliffs above the site. A single analysis point was evaluated for each pathway at the transition from the steeper slopes to the flatter slopes. The analysis point location was selected based on the most probable site for installation of rockfall mitigation systems. Bounce heights and kinetic energy results for each pathway and analysis point are shown in Table 1. Table 1 – Summary of Rockfall Modeling Pathway Rock Size (ft) Bounce Height (ft) Energy (kJ) 1 2 x 3 x 1.5 5 190 5 x 6 x 2 5 1220 2 2 x 3 x 1.5 5 182 5 x 6 x 2 5 1211 3 2 x 3 x 1.5 5 81 5 x 6 x 2 5 305 Existing Structure 5 x 6 x 2 2 300 Rockfall Hazard Evaluation Dever Subdivision Project No. 19-046G-H1 Glenwood Springs, Colorado 3.0 ANALYSIS SUMMARY Based on our investigation and analyses, 26 to 51 out of 100 simulated rockfall events travelling along the profiles analyzed would reach the flatter areas of the site where development is anticipated. Our analyses suggest rockfall mitigation systems should be designed for a 2000 kJ event and a minimum barrier height of 4 meters (13 feet) at the base of the existing slope and 500 kJ with a minimum barrier height of 5 feet at the existing structure. These values are based on the mitigation system being installed at the base of the steeper slope at the transition to the flatter slope areas. 4.0 MITIGATION OPTIONS Rockfall hazard mitigation can be accomplished with several techniques. Mitigation option(s) are selected based on accessibility of the site, potential size of events and cost. We considered draped mesh and/or cable net systems. However, we believe the upper portions of the source area are outside the subject property. To be effective, a drape mesh system would need to be installed to the top of the source area. If it is determined that the entire source area is within the subject property, a drape mesh system could be considered. As discussed, for a design energy of 2000 kJ and a minimum barrier height of 4 meters (13 feet), typical mitigation techniques include: x Barriers and Attenuators (Fences, walls and berms) x Scaling x Rock Bolting Discussions of recommended mitigation systems are discussed below. 4.1 Barriers and Attenuators Rockfall attenuator systems are designed to dissipate energy from a rolling rock and to reduce the energy of the rolling rock but let it migrate through the system. Rockfall barriers are designed to stop rocks at a given energy. Typically, these systems are set up across an active pathway chute either on the slope at the edge of development or at the base of slopes. Figures 6 and 7 depict a typical fence and attenuator system. Other barriers could include block or concrete walls and earthen berms with vertical upslope face. Rockfall Hazard Evaluation Dever Subdivision Project No. 19-046G-H1 Glenwood Springs, Colorado Figures 6 and 7 – Typical fence (left) and attenuator (right) application 4.2 Scaling Natural slopes and outcrops with loose rock that can easily be rolled will benefit the most from scaling. Scaling is an effective mitigation option, but usually only provides between 3 to 10 years of benefit before weathering and erosion necessitate more scaling. Scaling consists of workers rolling loose rocks off the natural slopes so that the rocks roll to a lower elevation. Scaling is a common method of maintenance and mitigation for rockfall but would require periodic scaling at 3 to 10-year intervals and rockfall would need to be contained so it does not impact structures or roadways. 4.3 Rock Bolting Rock bolt systems that are post-tensioned reinforcing systems typically provide additional confinement load to a rock feature or rock mass and/or increase the sliding resistance of a rock section along a discontinuity. Post-tensioned anchors are sometimes referred to as pre- stressed anchors. Post-tensioned anchors are divided into two separate sections along the reinforcement element: a bond length and a free or stressing length. It is necessary to have a free or stressing length to tension the bar against the bond length. It is also necessary to have the bond length behind the discontinuity that is to be stabilized. These systems are typically tensioned to loads that range from 30 to 120 kips. The application of this system is used to tension loose rock to the rock mass and is considered when rock is either surrounded by open discontinuities or the fractures are of a progressive nature. Due to the highly fractured nature of the cliffs, we anticipate a significant number of rock bolts would be required to stabilize the cliff area. This method would need to be used in conjunction with scaling. Rockfall Hazard Evaluation Dever Subdivision Project No. 19-046G-H1 Glenwood Springs, Colorado 5.0 SUMMARY OF RECOMMENDATIONS As discussed in this report, we believe a significant rockfall hazard is present in the west section of the site as shown on Sheet 1. We recommend rockfall mitigation be performed to mitigate the hazard to improvements in this area. Several mitigation options were discussed above. However, based on our experience, the most practical solutions for this site would be a rockfall mitigation system such as a: x Fence x Attenuator x Wall (Block or concrete) Our analyses suggest rockfall mitigation systems should be designed for a 2000 kJ event with a minimum height of 13 feet. The designer should use these values as a minimum for design of the selected system. Once final grading is established a revised rockfall model is recommended to verify the assumptions and design parameters. 6.0 LIMITATIONS This study has been conducted in accordance with generally accepted geological and geotechnical engineering practices in this area for use by the client. Undisturbed and disturbed slope rating and evaluation methods have a certain degree of variability and subjectivity that is inherent to the rating systems. Geologic assessment of the slopes and difficulty in accessing the disturbed and undisturbed natural outcrops also increases the rating uncertainty. The suggestions submitted in this report are based upon the data obtained from field reconnaissance and use of previously developed rating systems. Geologic conditions will also change over time periods, so that results of the rating systems will also change of time as slopes weather and erode. It should be noted that rockfall and rockfall events are sporadic and unpredictable. This report does not attempt to predict the average recurrence interval, magnitude, or location of a rockfall events. These factors cannot be predicted with rating systems. Consequently, neither the rockfall hazard in terms of probability of a rockfall at any specific location, nor the risk to people or facilities to such events are assessed in this report. Furthermore, rockfall can potentially occur at any time and at any location. Rockfall events could occur that exceed the anticipated Rockfall Hazard Evaluation Dever Subdivision Project No. 19-046G-H1 Glenwood Springs, Colorado energies and bounce heights. The analysis and recommendations attempt to predict the most probable rockfall events. The report was prepared in substantial accordance with the generally accepted standards of practice for geotechnical engineering as exist in the site area at the time of our investigation. No warranties, express or implied, are intended or made. Respectfully Submitted: RJ Engineering & Consulting, Inc. Richard D. Johnson, P.E. Principal Reviewed by: Ben Arndt, P.E. Principal z .,, Found 3.25' BLM Aluiollnu" Mon1,111errt: oderate to High Rockfall Hazard Mitigation required for improvements in this area =nw t::: [~Ion BureQU of LQnd MQnQger,ent -~~-------------------~~1284.82 ' • E 0 N SCALE: 100' 200' 1" = 200' PROJECT NO: Storl'I King Hunting Ro.nch LLC Rec, No, 658533 PROJECT: Sri 12:5' llrarlge Plastic co.p on No. 5 rftlCU" PLS 38«0. F'ol.nll 3,25• BLM MuN"IUPI Manul'l.,,t ,or the E4 Corner Sec:tlan I, T6S, R90V, 6th PM 19-046G-H1 Dever Subdivision, Parcels A & B Rockfall Hazard Area Sheet 1 Mudflow Analysis Tetra Tech Sopris Engineering, LLC WEST GLENWOOD SPRINGS DEVELOPMENT MUDFLOW ANALYSIS #100-WTR-T40119 April 15, 2022 [ 11:;] TETRA TECH Sopris Engineering, LLC This page intentionally left blank 111:: I TETRA TECH Sopris Engineering, LLC iii WEST GLENWOOD SPRINGS DEVELOPMENT MUDFLOW ANALYSIS #100-WTR-T40119 April 15, 2022 PRESENTED TO: PRESENTED BY: Sopris Engineering, LLC 502 Main Street, Ste A3 Carbondale, CO 81623 P +1-970-704 -3011 Soprisengineering.com Tetra Tech 3801 Automation Way, Suite 100 Fort Collins, CO 80026 P +1-970-223 -9600 Tetratech.com 111:: I TETRA TECH Sopris Engineering, LLC iv This page intentionally left blank. 111:: I TETRA TECH Sopris Engineering, LLC v CONTENTS 1. INTRODUCTION ............................................................................................................................. 1 2. MUDFLOW ANALYSIS ................................................................................................................... 3 2.1. MUDFLOW CHARACTERIZATION AND PROCESSES .............................................................. 3 2.2. FLO-2D MODEL ......................................................................................................................... 6 2.2.1. Model Extents and Topography ...................................................................................... 6 2.2.2. Overland Roughness Values .......................................................................................... 8 2.2.3. Infiltration ..................................................................................................................... 10 2.2.4. Channels ...................................................................................................................... 12 2.2.5. Reduction Factors and Walls ........................................................................................ 12 2.2.6. Hydraulic Structures ..................................................................................................... 12 2.3. HYDROLOGY ........................................................................................................................... 13 2.4. MUDFLOW HYDROGRAPHS ................................................................................................... 18 2.5. EXISTING CONDITIONS MODEL ............................................................................................. 23 2.5.1. Existing Conditions Model Results ................................................................................ 23 2.6. PROJECT CONDITIONS .......................................................................................................... 28 2.6.1. Project Conditions Model Results ................................................................................. 29 3. RECOMMENDATIONS.................................................................................................................. 35 4. REFERENCES .............................................................................................................................. 36 TABLES Table 1. Mudflow behavior as a function of sediment concentration (FLO-2D Manual, 2014) ...................................................................................................................4 Table 2. Manning's n Roughness Values ...........................................................................8 Table 3. Horton’s Infiltration Parameters for different hydrologic soil groups ....................10 Table 4. NRCS Soil types ................................................................................................10 Table 5. Peak rainfall for the 2-hour, 25 and 100-year events (inches) ............................13 Table 6. Summary of peak flow and volume for the 25- and 100 -year rainfall events.l .....17 Table 7. Summary of 2-hr 25-yr peak clearwater flow (cubic feet per second) and peak sediment concentrations for the mudflow sources ..............................................22 Table 8. Summary of 2-hr 100-yr peak clearwater flow (cubic feet per second) and peak sediment concentrations for the mudflow sources .....................................23 Table 9. Summary of flow volume leaving study site for the 25- and 100-year events (acre-feet). .........................................................................................................29 Table 10. Freeboard and Safety Factor Recommendations (copied from FEMA 2012) ......35 111:: I TETRA TECH Sopris Engineering, LLC vi FIGURES Figure 1. Proposed design and mudflow sources applied to the FLO-2D model .................2 Figure 2. Classification of hyper-concentrated sediment flows (modified from FLO-2D Manual, 2014). .....................................................................................................5 Figure 3. Extents of the FLO-2D model and basin elevations. .............................................7 Figure 4. Land-use zones used to assign Manning’s n-values to the FLO-2D model. .........9 Figure 5. NRCS Soil Mapping. ..........................................................................................11 Figure 6. Location of mudflow sources applied to the FLO-2D model................................14 Figure 7. Rainfall distribution for the 2-hour, 25 and 100-year rainfall events. ...................15 Figure 8. Predicted flow hydrographs for the 2-hour, 25-year rainfall event for sub- basins 1 to 6. .....................................................................................................16 Figure 9. Predicted flow hydrographs for the 2-hour, 100-year rainfall event for sub- basins 1 to 6. .....................................................................................................17 Figure 10. Clearwater hydrograph, sediment concentration (Cv) and bulked sediment hydrographs for Inflow Source 1 for the 2-hour, 25-year rainfall event. ..............19 Figure 11. Clearwater hydrograph, sediment concentration (Cv) and bulked sediment hydrographs for Inflow Source 2 for the 2-hour, 25-year rainfall event. ..............20 Figure 12. Clearwater hydrograph, sediment concentration (Cv) and bulked sediment hydrographs for Inflow Source 3 for the 2-hour, 25-year rainfall event. ..............20 Figure 13. Clearwater hydrograph, sediment concentration (Cv) and bulked sediment hydrographs for Inflow Source 4 for the 2-hour, 25-year rainfall event. ..............21 Figure 14. Clearwater hydrograph, sediment concentration (Cv) and bulked sediment hydrographs for Inflow Source 5 for the 2-hour, 25-year rainfall event. ..............21 Figure 15. Clearwater hydrograph, sediment concentration (Cv) and bulked sediment hydrographs for Inflow Source 6 for the 2-hour, 25-year rainfall event. ..............22 Figure 16. Maximum mudflow depth for the 2-hour 25-year rainfall event under Existing conditions...........................................................................................................24 Figure 17. Maximum mudflow velocity for the 2-hour 25-year rainfall event under Existing conditions...........................................................................................................25 Figure 18. Maximum mudflow depth for the 2-hour 100-year rainfall event under Existing conditions...........................................................................................................26 Figure 19. Maximum mudflow velocity for the 2-hour 100-year rainfall event under Existing conditions. ............................................................................................27 Figure 20. Predicted maximum mudflow depth for the 2-hour 25-year rainfall event under Project conditions. ..............................................................................................31 Figure 21. Predicted maximum mudflow velocity for the 2-hour 25-year rainfall event under Project Conditions. ...................................................................................32 Figure 22. Predicted maximum mudflow depth for the 2-hour 100-year rainfall event under Project conditions. ....................................................................................33 111:: I TETRA TECH Sopris Engineering, LLC vii Figure 23. Predicted maximum mudflow depth for the 2-hour 100-year rainfall event under Project conditions. ....................................................................................34 111:: I TETRA TECH Sopris Engineering, LLC viii This page intentionally left blank. 111:: I TETRA TECH Sopris Engineering, LLC ix EXECUTIVE SUMMARY MNE WG LLC is proposing to construct commercial storage units on undeveloped land located west of Glenwood Springs, CO and north of Interstate 70 (I-70). Sopris Engineering are the civil engineers for the project and sub-contracted Tetra Tech to perform the mudflow analysis. The Project is located near the base of Storm King Mountain on a series of alluvial fans. As part of Garfield County regulations, development on an alluvial fan must be protected on its uphill side without disturbing the upper watershed. As such, a mudflow analysis is required to evaluate the development risks. The development (Project) includes: (1) re-grading the ground, (2) construction of stormwater and debris flow basins, (3) construction of roads, storage units, and (4) construction of a new channels and installation of culverts. Tetra Tech developed FLO-2D models of the Existing and Project conditions to simulate the mudflows. The FLO-2D domain spans the watershed of the Project Site, extending roughly 670 acres from I-70 up the southern side of Storm King Mountain. The model has a 20-foot grid size and contains 73,002 grid cells. The Project Site is at an elevation of approximately 5,775 feet and the elevation at the top of the watershed is approximately 8,550-feet, generating slopes greater than 45 degrees in some areas, particularly on the western side of the basin. Two-hour hyetographs were developed to represent the short-duration thunderstorm events for the 25- and 100-year peak rainfall events based on the Colorado Unit Hydrograph Procedure (CUHP) developed by the Urban Drainage and Flood Control District (UDFCD, 2014. The 2-hour 25- and 100-year rainfalls are 1.22 and 1.56 inches, respectively. A digital terrain model (DTM) was developed to represent the Existing conditions based on 2018 LiDAR mapping that was obtained from the USGS and from topographic mapping provided by Sopris Engineering. The DTM has a 2-foot pixel resolution and was used to assign elevations to the FLO-2D grid elements. Manning’s n-values roughness polygons were delineated in ArcGIS, a Geographic Information Software (GIS) program, to represent zones with similar roughness characteristics based on aerial photography, field reconnaissance, and site plans. The specific Manning’s n-values were assigned to the roughness polygon based on guidance in the FLO-2D manual. Soil infiltration losses in FLO-2D were modeled Horton’s soil-infiltration (Horton, 1933). Soil mapping was obtained from the NRCS and Horton infiltration parameters were assigned to each soil group based on values reported in the Colorado Urban Hydrograph Procedure (CUHP). The Existing conditions model was initially run using the rainfall/infiltration capabilities for the 2- hour, 25- and 100-year rainfall events to predict the clearwater flow hydrographs at six source locations that debris flow could potentially originate from. The clearwater hydrographs were then bulked to represent mudflow using a variable sediment concentration hydrograph. The FLO-2D model was run using the mudflow capabilities for the Existing and Project conditions for the following hydrologic scenarios: x 2-hour 25-year runoff hydrograph with sediment bulking up to 50-percent by volume x 2-hour 100-year runoff hydrograph with sediment bulking up to 20-percent by volume 111:: I TETRA TECH Sopris Engineering, LLC x The Existing conditions model was modified to represent the Project design including regrading, construction of sediment basins, culverts and channels. The FLO-2D grid elevations were modified to reflect the grading and reported basin storage capacity in the design plans. Area and width reduction factors were applied to the model to reflect the loss of storage and blocking of flow from the buildings, and roughness values were changed to reflect the development. The Project conditions model was run over the same 25 -year and 100-year peak flow hydrographs as the Existing conditions model and the model output was used to map and evaluate the changes in mudflow depths and velocities. Following is a summary of the model results: x The proposed sediment basins are adequately sized and located to capture sediment and the 60” culverts are effective to convey flow from the basins. x Overland mudflow from two sources upstream of the development deposits on the uphill (northern) side of three buildings with depth of less than 1-foot under the 25-year event and depths of up to 2 feet under the 100-year event. It is recommended that the upstream side and building be constructed to withstand debris flows, and a 3-foot freeboard is recommended based on FEMA criteria. Based on these recommendations, the project will meet the Garfield County regulations for protecting the uphill side of the buildings without disturbing the upper watershed. x The proposed sedimentation basins store sediment and reduce the volume of sediment flowing off the south boundary of the property and onto the frontage road, and potentially onto I-70. x The proposed project decreases flooding on the neighboring property to the east. This page intentionally left blank. 111:: I TETRA TECH Sopris Engineering, LLC 1 INTRODUCTION KOA Holdings Inc. is proposing to construct commercial storage units on undeveloped land located west of Glenwood Springs, CO and north of Interstate 70 (I-70) (Figure 1). Sopris Engineering are the civil engineers for the project and sub-contracted Tetra Tech to perform the mudflow analysis. The Project is located near the base of Storm King Mountain on a series of alluvial fans. As part of Garfield County regulations (Garfield County, 2020), development on an alluvial fan must be protected on its uphill side without disturbing the upper watershed. As such, a mudflow analysis is required to analyze development risks. The development (Project) includes: x re-grading the ground x construction of stormwater and debris flow basins x construction of roads and storage units x construction of a new channel (Figure 1). The grading for the Existing conditions and the grading and design plans for the Project conditions were provided by Sopris Engineering, LLC (2021 and 2022a). Tetra Tech developed FLO-2D models (FLO-2D, 2021) of the Existing and Project conditions to perform the mudflow modeling. The models were initially run using the rainfall/infiltration capabilities for the 2-hour, 25- and 100-year rainfall events to predict the clearwater flow hydrographs at six source locations that debris flow could potentially originate from. The clearwater hydrographs were then bulked to represent mudflow using a variable sediment concentration hydrograph. The Existing and Project conditions mudflow models were run for the following hydrologic scenarios: x 2-hour 25-year runoff hydrograph with sediment bulking up to 50-percent by volume x 2-hour 25-year runoff hydrograph with sediment bulking up to 20-percent by volume The Project impacts were evaluated from comparing the differences in the Existing and Project conditions model output, including changes in mudflow depths, velocities, and flow. 1. I "11:: I TETRA TECH Sopris Engineering, LLC 2 Figure 1. Proposed design and mudflow sources applied to the FLO-2D model. c:J Project Footprint -Debris Cul verts ~Asphalt 8 0 [ "1\-: I TETRA TECH Wall -storm water Culverts -Concrete c::::J Basins -Buidings ····Gravel -In flows 300 600 Feet I 11; I TETRA TECH Sopris Engineering, LLC 3 MUDFLOW ANALYSIS The Existing conditions FLO-2D model was initially run using the rainfall/infiltration capabilities to estimate the clearwater flow hydrographs at six sub-basins that were identified as having the potential to create mudflows. The sub-basins as numbered 1 to 6 from west to east (Figure 1). The model was run for the 2- and 24-hour, 2- through 100-year rainfall events. The predicted flow hydrographs were modified to represent the sediment bulking that could potentially occur during mudflow events. The Existing and Project conditions models were then run for the 2- and 24-hour, 2- through 100-year mudflow hydrographs and the model output was compared to evaluate impact of the project. MUDFLOW CHARACTERIZATION AND PROCESSES Hyper-concentrated sediment flows (mudflows and mud floods) are part of a continuum in the “physics of flowing water and sediment movement that ranges from clear water flow to mass wasting processes (landslides)” (SLA and O’Brien 1989). In general, the sediment-transport characteristics in the continuum range from suspended and bed load transport in water floods to mass wasting in landslide events. The National Research Council Committee (NRC 1982) proposed four categories to delineate this continuum: water floods, mud floods, mudflows, and landslides (Table 1). The bounds of each of these categories can be approximated based on the fluid properties, and specifically by the sediment concentration (by volume) of the fluid (Figure 2). The sediment concentration of fluid is defined as the ratio of the sediment volume to the water volume and is given by: CV = Volume of Sediment / (Volume of Water + Volume of Sediment) CV = Volume of Sediment / (Volume of Water + Volume of Sediment) The continuum indicates that water floods are mostly comprised of water with some sediment (low concentration of sediment), whereas landslides are mostly comprised of bulk sediment with some water (high concentration of sediment). The concentration of the sediment is an important component in determining the physical processes that govern the behavior of the fluid-sediment mixture in each of these categories. For example, the flow characteristics of a mud flood are dominated by the turbulent and viscous forces within the fluid matrix; whereas, movement of a landslide is dominated by the dispersive stresses and particle friction. This study focuses on the sediment-transport characteristics of the mud flood and mudflow categories. However, a brief description of the sediment transport characteristics of the water floods and land sliding events is presented for the purpose of describing the bounding categories. Flood flows generally have sediment concentrations of less than 20 percent (by volume). They are essentially water floods with high bed load and suspended loads where the bed load may be affected by the high concentration of suspended load (i.e., fine sediment wash load). The sediment-transport characteristics of water floods are modeled using conventional bed- and suspended-load formulas and methodologies. Landslides generally have sediment concentrations greater than 55 percent (by volume) and are considered as bulk solid movement as opposed to fluid motion. Landslides may range from slow- moving earth flow and creeping soil masses to rapid rotation or slippage failures. 2. 2.1. I "11:: I TETRA TECH Sopris Engineering, LLC 4 Hyper-concentrated sediment flows are defined as flood events with sediment concentrations that range between approximately 20 and 55 percent by volume. However, the sediment concentration for a given event is generally considered to be between 20 and 50 percent (O’Brien 2004). The fine sediment concentration (silt, clay and fine sands in the fluid matrix) controls the properties of the fluid, including, viscosity, density, and yield stress. Mudflows are non-Newtonian and they have much higher viscosities and densities compared to water flows. These properties result in mudflows having significantly slower velocities compared to water floods on the same slope. The fine sediments increase the density of the fluid matrix, which increases the buoyancy of sediments thereby creating conditions that allow gravel to boulder-sized material to be transported near the flow surface by mudflows. The yield stress is a measure of the internal fluid resistance to flow and affects both the initiation and cessation of flows. For the purposes of this report, all hyper- concentrated sediment flows (mud floods and mudflows) will be referred to as mudflows. Table 1. Mudflow behavior as a function of sediment concentration (FLO-2D Manual 2014) Event Sediment Concentration Flow Characteristics by Volume by Weight Landslide 0.65 - 0.80 0.83 - 0.91 Will not flow; failure by block sliding 0.55 - 0.65 0.76 - 0.83 Block sliding failure with internal deformation during the slide; slow creep prior to failure Mudflow 0.48 - 0.55 0.72 - 0.76 Flow evident; slow creep sustained mudflow; plastic deformation under its own weight; cohesive; will not spread on level surface 0.45 - 0.48 0.69 - 0.72 Flow spreading on level surface; cohesive flow; some mixing Mud Flood 0.40 - 0.45 0.65 - 0.69 Flow mixes easily; shows fluid properties in deformation; spreads on horizontal surface but maintains an inclined fluid surface; large particle (boulder) setting; waves appear but dissipate rapidly 0.35 - 0.40 0.59 - 0.65 Marked settling of gravels and cobbles; spreading nearly complete on horizontal surface; liquid surface with two fluid phases appears; waves travel on surface 0.30 - 0.35 0.54 - 0.59 Separation of water on surface; waves travel easily; most sand and gravel has settled out and moves as bed load 0.20 - 0.30 0.41 - 0.54 Distinct wave action; fluid surface; all particles resting on bed in quiescent fluid condition Water Flood < 0.20 < 0.41 Water flood with conventional suspended load and bed load 111:: I TETRA TECH Sopris Engineering, LLC 5 Figure 2. Classification of hyper-concentrated sediment flows (modified from FLO-2D Manual 2014). The sediment matrix of a hyper-concentrated flow is non-homogeneous, and the sediment properties change significantly as they flow down steep watershed channels or across alluvial fans. As the mudflow moves over the alluvial fan, dewatering of the fluid matrix can occur by infiltration and escapement to the surface. This may further increase the concentration of the hyper-concentrated sediment flows and alter the transport characteristics of the flow. “Almost all hyper-concentrated sediment flows are fully turbulent, unsteady and non-uniform, and are characterized by surging, flow cessation, blockage, and roll waves” (SLA and O’Brien 1989). During a mudflow event, the average sediment concentration over the duration of the hydrograph generally ranges between 20 and 35 percent by volume with peak concentrations approaching 50 percent (Figure 2 and Table 1). Most watersheds with a history of mudflow events will eventually develop a sediment supply in the channel bed such that even relatively small rainfall- runoff storms may generate mudflow surges. In general, mudflows have a distinct pattern of flood evolution. Initially, clear water flows from the basin rainfall-runoff may arrive at the fan apex. This may be followed by a surge or frontal wave of mud and debris (40- to 50-percent concentration by volume). When the peak arrives, the average sediment concentration generally decreases to the range of 30 to 40 percent by volume. On the falling limb of the hydrograph, the sediment concentration decreases due to the reduced availability of sediment; however, surges of higher sediment concentration may occur. 0.0 0.1 0.2 0.3 0.4 0.5 0.6 0.7 0.8 0.9 1.0 Concentration by Volume (C V) 0.0 0.1 0.2 0.3 0.4 0.5 0.6 0.7 0.8 0.9 1.0 Concentration by Weight (CW)Water FlowTransition ZoneMud FloodM ud FlowLandslide111:: I TETRA TECH Sopris Engineering, LLC 6 FLO-2D MODEL FLO-2D is a 2-dimensional (2-D) hydraulic model that was developed to perform both clearwater, sediment-transport, and hyper-concentrated sediment flow-routing in channels and/or on alluvial fans with an unconfined flow path. The model utilizes a volume conservation scheme to simulate both sub- and super-critical flows in the channel or floodplains, as well as flows exiting from the channel to the floodplain, and vice versa. Overland flow is modeled using a 2-D diffusive wave approximation of the momentum equation. A central difference routing scheme with eight potential flow directions is used to simulate the progression of the flood wave hydrograph over a system of square grids. The FLO-2D model contains several components that are used to represent and model the complex topography and processes, including: channel-floodplain flow exchange; loss of storage due to buildings; flow obstructions; simulation of hydraulic structures; simulation of street flow; and simulation of hyper-concentrated sediment flows (mudflows). Hyper-concentrated sediment flow is simulated by the FLO-2D model using a quadratic rheological model that includes viscous stress, yield stress, turbulence, and dispersive stress terms as a function of sediment concentration. FLO-2D does not have the ability to model unsteady phenomena such as surging. It also assumes a rigid boundary, and therefore, does not model channel, overbank, or fan degradation. MODEL EXTENTS AND TOPOGRAPHY The model domain spans the watershed of the Project Site, extending roughly 670 acres from I- 70 up the southern side of Storm King Mountain (Figure 3.). The model has a 20-foot grid size and contains 73 ,002 grid cells. The Project Site is at an elevation of approximately 5,775 feet and the elevation at the top of the watershed is approximately 8,550-feet, generating slopes greater than 45 degrees in some areas, particularly on the western side of the basin. A digital terrain model (DTM) was developed to represent the Existing conditions based on 2018 LiDAR mapping that was obtained from the USGS and from topographic mapping provided by Sopris Engineering (2021). The DTM has a 2 -foot pixel resolution and was used to assign elevations to the grid elements. The Existing conditions model was modified to represent Project design provided by Sopris Engineering (2022a). 2.2. 2.2.1. 111:: I TETRA TECH Sopris Engineering, LLC 7 Figure 3. Extents of the FLO -2D model and basin elevations. I 11::] TETRA TECH D Proj ect Footprint I 11; I TETRA TECH 0 1,300 Feet 2,600 Sopris Engineering, LLC 8 OVERLAND ROUGHNESS VALUES Manning’s n-values roughness polygons were delineated in ArcGIS, a Geographic Information Software (GIS) program, to represent zones with similar roughness characteristics based on aerial photography, field reconnaissance, and site plans. The specific Manning’s n-values were assigned based on guidance in the FLO-2D manual (FLO-2D 2014). The n-values assigned to these areas ranged from 0.02 for roads (Project conditions), which are relatively smooth, to 0.35 for sparse rangeland with less than 20% ground vegetation cover and sandy to rocky soils. Land classifications and associated n-values are provided in Table 2 and the land use mapping is shown in Figure 4. Table 2. Manning's n Roughness Values Land Use Manning’s n Roughness Value Urban/Structures 0.04 Roads/Streets 0.02 Medium Forest 0.35 Alluvial Fan 0.20 Light Scrub 0.30 Rock Outcrop 0.30 Campground 0.25 2.2.2. 111:: I TETRA TECH Sopris Engineering, LLC 9 Figure 4. Land-use zones used to assign Manning’s n-values to the FLO-2D model. 111: I TETRA TECH Cl Model Domain Light Scrub Cl Project Footprint • Medium Forest I 11; I TETRA TECH Gampgound • Roc k Outcrop Alluvial Fan 0 1,400 2,800 Feet Sopris Engineering, LLC 10 INFILTRATION Soil infiltration losses in FLO-2D were modeled Horton’s soil-infiltration (Horton 1933), which consists of an initial infiltration rate (fi), a final infiltration rate (f0), and a decay coefficient (a) (Table 3). The CUHP program lists the Horton parameters for a range of NRCS Hydrologic Soil Groups (UDFCD 2005). In general, the Horton parameters vary with soil type (for example clay, loam, sand, bedrock) and degree of saturation (dry, moist). The soil infiltration properties applied to each sub-basin were based on Hydrologic Soil Groups provided with the NRCS soil mapping. The majority of the soils are classified as Hydrologic Soil Group (HSG) B (Table 4 and Table 5). The Cochetopa-Jerry Complex was mapped as HSG D, but due to the slow regrowth from the Storm Peak Fire, the more conservative HSG C was used. Table 3. Horton’s Infiltration Parameters for different hydrologic soil groups Hydrologic Soil Group Initial Rate (in/hour) Final Rate (in/hour) Decay Coefficient (1/second) A 5.0 1.0 0.0007 B 4.5 0.6 0.0018 C 3.0 0.5 0.0018 D 3.0 0.5 0.0018 Table 4. NRCS Soil types MYSUM Soil Name HSG 2 Arle-Ansari Rock Complex C 8 Antencio-Zeltine Complex C 19 Cochetopa-Jerry Complex B (used C) 39 Jerry Loam D 69 Torriorthents-Rock Outcrop C 2.2.3. l l f 111: I TETRA TECH Sopris Engineering, LLC 11 Figure 5. NRCS Soil Mapping. Legend Soil Types MYSYM, Soil Name • 2 , Arie-Ansari Rock Outcrop Comp le x 8 , Antencio -Zeltine Comple x 19 , Cochetopa-Jerry Comple x 39 , Jerry Loam , HSG C 67 , Torriorthents-Rock Outcrop [ 11: I TETRA TECH I 11; I TETRA TECH Soil Mapping a o---■1 ■,5c00======3~,000 W Feet Sopris Engineering, LLC 12 CHANNELS Multiple channels are a simple option in FLO-2D used to represent the maximum depths, widths, slopes, and roughness characteristics of small defined channels, typically rills. Differently, the Channel Tool provides a more complex option in FLO-2D for defining specific geometry of larger channels. Channel elements have different conveyance and storage properties compared to the floodplain elements. Channel elements are important as they act as conduits for conveying flood flows and can store sediment. They are applied when width of the channel is less than the width of the element. In the models developed for this study, the channels are narrower than the 20- foot elements. Thus, to better represent the channels in the model, the channel grid elements were assigned Manning’s n-values of 0.10. Rills were included in both Existing and Project conditions models, while a channel along the eastern edge of the property was modeled with the Channel Tool. This eastern channel contains a series of small debris flow basins to store and slow debris flow. The channel geometry was represented by cutting cross-sections from the Project conditions DTM and inputting the trapezoidal channel geometry in the FLO-2D model. REDUCTION FACTORS AND WALLS Other model parameters typically applied to FLO-2D models include width reduction factors (WRFs) and area reduction factors (ARFs). The WRFs and ARFs are assigned to the FLO-2D grid elements to represent the blockage of flow paths and reduction in storage that mostly occur due to the presence of buildings. Width reduction factors are applied to represent the blockage of flow through the side of an element, while ARFs represent the loss of floodplain storage volume due to the buildings. For example, a wall might obstruct 40 percent of the flow width of a grid element side and a building could cover 75 percent of the same grid element. Proposed design structures provided by Sopris Engineering (2021b) included building outlines (Figure 1). A shapefile was generated from these structures and was used to assign the ARFs and WRFs to grid elements using the model development tools in FLO-2D for the Project Conditions models. The proposed design also includes an 8-ft wall along the northern and western perimeter of building A4. This wall was modeled using the levee tool in FLO-2D. HYDRAULIC STRUCTURES Hydraulic structures, such as culverts, pipes, weirs, etc., can be incorporated in a FLO-2D model. The design includes four 60” culverts for conveying water from debris flows out of basins, and three 12” culverts for stormwater. All culverts will be ADS N-12 and were assigned roughness values of 0.015 (Sopris Engineering 2022b; ADS 2017). The slope of each culvert was calculated from invert and daylight elevations, and culvert lengths provided by Sopris Engineering (2022b). Using a pipe’s diameter, slope, and roughness derived from its material, a rating curve can be developed following the methods of the National Engineering Handbook (NRCS 2012). This approach was used for the culverts proposed in the Project conditions. DETENTION BASINS The proposed design (Figure 1) contains four detention basins for storing water and sediment and reducing the debris flow velocity. These basins are sized to capture the sediment from the 2- hr 25-yr debris flow event while allowing clearwater to drain through 60” culverts. 2.2.4. 2.2.5. 2.2.6. 2.2.7. 111:: 1 TETRA TECH Sopris Engineering, LLC 13 FLO-2D models of the study site were assigned a 20-ft grid. As such, the storage capacity of each basin was analyzed and corrected to reflect the 20-ft resolution. The exact grid cells belonging to each basin were identified by summing 20-ft x 20-ft squares until the total was closely matched to the values provided by Sopris Engineering (2022b). Storage capacity for each one of these squares was computed by multiplying the difference between the elevation at the top of the basin and the grid cell average elevation by the 20-ft x 20-ft area. Total storage was summed for all grid cells per basin and compared to the provided values. HYDROLOGY A hydrology analysis was conducted using the FLO-2D model to determine the peak flows at 6 sub-basins that were identified as having the potential to create mudflows (Figure 6). A 2-hour hyetograph was developed to represent the short-duration thunderstorm events for the 25- and 100-year peak rainfall events based on the Colorado Unit Hydrograph Procedure (CUHP) developed by the Urban Drainage and Flood Control District (UDFCD 2014). The 2-hour hyetograph is developed based on the 1-hour point rainfall depth, similar to the design storm used by UDFCD, but adjusted for Glenwood Springs precipitation frequency (Table 5 and Figure 7) The process used for developing 2-hour hyetographs from one-hour point rainfall depths is described in the Rainfall Chapter of the Aspen Urban Runoff Management Plan (City of Aspen 2014). The adjusted 2-hour 25- and 100-year rainfalls are 1.22 and 1.56 inches, respectively (Table 5). Table 5. Peak rainfall for the 2-hour, 25 and 100-year events (inches) Event 1-Hour NOAA Atlas 14 Value 2-Hour CUHP Adjusted 25-Year 1.06 1.22 100-Year 1.35 1.56 2.3. 111:: I TETRA TECH Sopris Engineering, LLC 14 Figure 6. Location of mudflow sources applied to the FLO-2D model. , , I TETRA TECH c:J Project Footprint ~ Asph alt -Debris C ulvert s -Inflows -Build ings -Concrete --Sto rmwater Cu lvert s Ba sins : : : : Gravel Wal Feet 111:: I TETRA TECH Sopris Engineering, LLC 15 Figure 7. Rainfall distribution for the 2-hour, 25 and 100 -year rainfall events. The FLO-2D model was run for the 24-hour, 25- and 100 -year peak rainfall events. Figure 8 and Figure 9 show the precited flow hydrographs and Table 6 summarizes the peak flow and volumes. 0.4 -25-Year 0.35 -100-Year 0.3 0.25 ----:- C = .c i5.. Q) 0.2 0 .;!1 C "iij 0::: 0.15 0.1 0.05 0 0 0.5 1.5 2 2.5 Time (hours) I 11; 1 TETRA TECH Sopris Engineering, LLC 16 Figure 8. Predicted flow hydrographs for the 2-hour, 25-year rainfall event for sub-basins 1 to 6. 90 -Sub-Basin 1 -Sub-Basin 2 80 -Sub-Basin 3 -Sub-Basin 4 70 -Sub-Basin 5 -Sub-Basin 6 60 ~50 -S ;; 0 U:: 40 30 20 10 0 0 0.5 1.5 2 2.5 3 Time (hours) 111:: I TETRA TECH Sopris Engineering, LLC 17 Figure 9. Predicted flow hydrographs for the 2-hour, 100-year rainfall event for sub-basins 1 to 6. Table 6. Summary of peak flow and volume for the 25- and 100-year rainfall events. Inflow 25-Year Peak Clearwater Flow (cfs) 25-Year Clearwater Volume (ac-ft) 100-Year Peak Clearwater Flow (cfs) 100-Year Clearwater Volume (ac-ft) Source 1 81 5.80 135 10.44 Source 2 0.3 0.01 0.4 0.02 Source 3 18 0.97 26 1.29 Source 4 18. 1.28 28 2.20 Source 5 1 0.03 2 0.05 Source 6 13 0.73 20 1.02 160 -Sub-Basin 1 -Sub-Basin 2 140 -Sub-Basin 3 -Sub-Basin 4 -Sub-Basin 5 120 -Sub-Basin 6 100 ~ -S-80 ;;: 0 u::: 60 40 20 0 0 0.5 1.5 2 2.5 3 Time (hours) I 111:: I TETRA TECH Sopris Engineering, LLC 18 MUDFLOW HYDROGRAPHS The clearwater hydrographs were bulked with sediment using a developed sediment concentration (by volume, Cv) hydrograph to represent the mudflow hydrograph. The total volume of the water and sediment in a mudflow can be determined by multiplying the clearwater volume by the bulking factor, where the bulking factor is defined by: ܤܨ =1 (1 െܥ௩ ) For example, a sediment concentration of 10 percent (Cv=0.10) creates a bulking factor of 1.11, indicating the flood volume is 11 percent greater than if the flood was considered to be only water. The sediment concentration hydrograph for the four larger sources represents the likely variation in sediment concentration throughout the storm hydrograph and has the following characteristics: x The initial rising limb and the last part of the recessional limbs of the hydrographs have a sediment concentration of 20 percent, which corresponds to the minimum concentration for a mudflow. x The steep rising limb of the hydrograph is bulked to a maximum concentration of 50 percent to simulate the frontal wave of the mudflow. The peak of the sediment concentration hydrograph occurs 6 minutes before the peak of the clearwater hydrograph. x The sediment concentration at the peak of the clearwater hydrograph is less than the peak sediment concentration in order to simulate water dilution. x The average sediment concentration over the hydrograph is approximately 30 percent. Figure 10 to Figure 15 show the representative clearwater, sediment and bulked flow hydrographs for the six mudflow sources, and Table 7 and Table 8 summarize the bulked flow hydrographs for the 25- and 100-year events, respectively. 2.4. 111:: I TETRA TECH Sopris Engineering, LLC 19 Figure 10. Clearwater hydrograph, sediment concentration (Cv) and bulked sediment hydrographs for Inflow Source 1 for the 2-hour, 25-year rainfall event. 160 0 .6 -Clearwater Flow 140 -Bulked Flow 0 .5 120 -Sediment -Concentration 0 0 .4 ::> 100 >, ..Cl in --c.,) ~ 80 0 .3 6 3:: () ..2 c LL 60 Q) E 0 .2 '6 Q) 40 CJ) 0 .1 20 0 0 0 0 .5 1.5 2 2 .5 3 Time (hrs) 111:: I TETRA TECH Sopris Engineering, LLC 20 Figure 11. Clearwater hydrograph, sediment concentration (Cv) and bulked sediment hydrographs for Inflow Source 2 for the 2-hour, 25-year rainfall event. Figure 12. Clearwater hydrograph, sediment concentration (Cv) and bulked sediment hydrographs for Inflow Source 3 for the 2-hour, 25-year rainfall event. 0.35 0 .30 0 .25 ~0.20 ~ ,: 0 u::: 0.15 0.10 0 .05 0.00 111:: I TETRA TECH ~------------------------------~ 0 .25 g >- -Clearwater Discharge -Bulked Flow 0 .15 e -Sediment Concentration 0 .1 0 .05 .._ ___ ..._ ____________ _,,~-------------'-0 0 35 30 25 ;§' 20 ~ ~ ~ 15 10 5 0 0 0 .5 0.5 1.5 Time (hrs) 1.5 Time (hrs) 2 2 2 .5 3 0 .6 -Clearwater Disharge -Bulked Flow 0 .5 -Sediment Concentration ---:- 04 g >, e c..i 0 .3 C 0 (.) c Q) E 0 .2 '6 Q) en 0 .1 0 2 .5 3 (.) C 0 (,) c <I) E -0 <I) CJ) Sopris Engineering, LLC 21 Figure 13. Clearwater hydrograph, sediment concentration (Cv) and bulked sediment hydrographs for Inflow Source 4 for the 2-hour, 25-year rainfall event. Figure 14. Clearwater hydrograph, sediment concentration (Cv) and bulked sediment hydrographs for Inflow Source 5 for the 2-hour, 25-year rainfall event. 1.2 0 .25 1.0 0 .2 ,...,. 0 .8 -Clearwater g Discharge >, ~ -Bulked Flow 0 .15 e (.) u -;o.6 C 0 0 -Sediment u LL Concentration 0 .1 c (l) 04 E 'o (l) Cf) 0 .05 0 .2 0 .0 0 0 0 .5 1.5 2 2 .5 3 Time (hrs) 1.2 0 .25 1.0 0 .2 ,...,. 0 .8 -Clearwater g Discharge >, ~ -Bulked Flow 0 .15 e (.) u -;o.6 C 0 0 -Sediment u LL Concentration 0 .1 c (l) 0 .4 E 'o (l) Cf) 0 .05 0 .2 0 .0 0 0 0 .5 1.5 2 2 .5 3 Time (hrs) 111:: I TETRA TECH Sopris Engineering, LLC 22 Figure 15. Clearwater hydrograph, sediment concentration (Cv) and bulked sediment hydrographs for Inflow Source 6 for the 2-hour, 25-year rainfall event. Table 7. Summary of 2-hr 25-yr peak clearwater flow (cubic feet per second) and peak sediment concentrations for the mudflow sources Inflow Peak Clearwater Flow (cfs) Clearwater Volume (ac-ft) Peak Bulked Flow (cfs) Bulked Volume (ac-ft) Sediment Volume (ac-ft) Max Conc. Source 1 81 5.80 144 8.37 2.57 0.50 Source 2 0.3 0.01 0.3 0.01 0.00 0.20 Source 3 18 0.97 32 1.43 0.46 0.50 Source 4 18 1.28 32 1.82 0.54 0.50 Source 5 0.9 0.03 1 0.03 0.01 0.20 Source 6 13 0.73 22 1.05 0.32 0.50 25 20 -15 ,,, -u -3: 0 LL. 10 5 0 0 111:: I TETRA TECH 0.5 1.5 Time (hrs) 2 0 .6 -Clearwater Discharge 0 .5 -Bulked Flow ..-... 0 0.4:::,. -Sediment >, Concentration ..0 - (.) C 0 .3 o () _, C Q.) E 0 .2 i5 Q.) (/) 0 .1 2 .5 3 Sopris Engineering, LLC 23 Table 8. Summary of 2-hr 100-yr peak clearwater flow (cubic feet per second) and peak sediment concentrations for the mudflow sources Inflow Peak Clearwater Flow (cfs) Clearwater Volume (ac-ft) Peak Bulked Flow (cfs) Bulked Volume (ac-ft) Sediment Volume (ac-ft) Max Conc. Source 1 135 10.44 168 13.01 2.57 0.20 Source 2 0.4 0.02 0.5 0.02 0.00 0.20 Source 3 26 1.29 1.6 6.44 0.32 0.17 Source 4 28 2.20 34 2.66 0.46 0.17 Source 5 2 0.05 2.5 0.06 0.01 0.20 Source 6 20 1.02 25 1.27 0.25 0.20 EXISTING CONDITIONS MODEL The FLO -2D model was run for the 2-hr 25 and 100-year peak flow events and the model output was used to develop depth and velocity inundation mapping. EXISTING CONDITIONS MODEL RESULTS For the 25-year event, the extents of the mudflow and the maximum flow depths are substantial (Figure 16 ). Furthest to the west, Inflow Source 1 is relatively channelized and produces a deep and narrow debris path that slightly fans out on the project site. Flow depths from Source 1 exceed 10 feet. Source 2 is minor and contributes to Source 3, which fans out on the property at depths approaching 4 feet. Like Source 1, Source 4 remains relatively deep and channelized until it fans out on the property. Depths from Source 4 are about half that of Source 1; however, some flow from Source 4 spreads to the east where it is almost intercepted by Sources 5 and 6. Source 5 is minor and contributes to Source 6, which splits into three major flowpaths with flow depths generally less than 2 feet: one path within the project site, another along its border, and a final path on the neighboring property to the east. Maximum velocities for Existing conditions (Figure 17 ) within the site exceed 4 ft/s only in the southeast corner of the flow extent of Inflow Source 1. Velocities are generally low due to the viscous nature of debris flows. Most velocities from Inflow Sources 1 and 4 are less than 2 ft/s. Most velocities for the remining Inflow Sources are less than 1 ft/s. For the 100-year event, the flooding patterns are similar to the 25 -year event, with significant inundation across the fan, especially from mudflow sources 3, 4 and 6. The velocities in the main channels are about 3 to 4 ft/s and up to 2 ft/s across the fan. l 2.5. 2.5.1. 111:: I TETRA TECH Sopris Engineering, LLC 24 Figure 16. Maximum mudflow depth for the 2-hour 25-year rainfall event under Existing conditions. The design is shown for reference purposes only. I "11; I TETRA TECH D Basins D Project Footprint --Stormwater Culverts -Buildings -Inflows 111:: I TETRA TECH -Concrete ····Gravel 0.00 -0 .50 0.51 -1 .00 1.01 -2.00 2.01 -3 .00 3.01 -5 .00 5.01 -7.00 7.01 -10.00 0 325 650 Feet Sopris Engineering, LLC 25 Figure 17. Maximum mudflow velocity for the 2-hour 25 -year rainfall event under Existing conditions. The design is shown for reference purposes only. [ '11: I TETRA TECH D Basins D Project Footprint -Stormwater Culverts -Buildings -Inflows I 11; I TETRA TECH -Concrete ····Grave l 8 0 325 650 Feet Sopris Engineering, LLC 26 Figure 18. Maximum mudflow depth for the 2-hour 100-year rainfall event under Existing conditions. The design is shown for reference purposes only. I "11; I TETRA TECH I 11; I TETRA TECH Wall D Basins c:J Project Footprint -Inflows --Debris Culverts --Stormwater Culverts -Bu ildings -Concrete ····Gravel 8 0 325 650 Feet Sopris Engineering, LLC 27 Figure 19. Maximum mudflow velocity for the 2-hour 100 -year rainfall event under Existing conditions. The design is shown for reference purposes only. I "1':: l TETRA TECH I 11; I TETRA TECH D Basins D Pro ject Footprint -Inflo ws --Stormwater Culverts -Build ings -Concrete ••••Gravel 8 0 325 650 Feet Sopris Engineering, LLC 28 PROJECT CONDITIONS The proposed Project conditions model was developed by modifying the Existing conditions model to represent the project regrading and structures as shown in the design plans (Figure 1). The intent for all features is to protect the storage units during mudflow events, reduce flow across and onto the frontage road, and ensure no increase in mudflow on the neighboring property to the east. The design features for each mudflow source include: x Mudflow source 1 – Excavation of the existing mudflow basin to store 3.763 acre-feet and installation of 5-foot diameter culvert to convey flows under the road. x Mudflow source 2 – Construction of a detention basin to store 1.27 acre-feet of sediment and installation of a 5-foot diameter culvert between two sets of storage units. Based on discussion with Sopris, they are proposing to install a series of steel columns driven vertically into the channel bed on the upstream side of the culvert that will trap larger sediments and prevent them entering (and potentially blocking the culvert) while allowing the water to continue to flow down the culvert. The steel sediment columns are not represented in the model. x Mudflow source 3 – Construction of a detention basin to store 1.27 acre-feet of sediment x Mudflow source 4 – Construction of 4 detention basins with a total of 1.892 acre-feet of storage and installation of a 5-foot diameter culvert under the road and between two sets of detention basins. x Mudflow source 5 – A mudflow protection wall along the uphill side of the storage units. This is a small mudflow source that generates about 1 cfs at the 25-year event and 2 cfs at the 100-year event. x Mudflow source 6 – Construction of a channel along the eastern boundary of the property. The upstream end of the channel will be located just west of a topographic ridge. Mudflows will need to flow over the ridge into the constructed channel. The channel has been designed as a series of 6 mini detention basins to store sediment and reduce the velocity. Based on discussion with Sopris, they are proposing to install a series of steel columns driven vertically into the channel bed, which will trap larger sediments and allow the water to continue to flow down the channel. The sediment traps were modeled by increasing the ground elevation by 2 to 4 feet at the downstream end of each basin. The hydraulic structures option in FLO -2D was used to represent the proposed culverts. The FLO- 2D grid elevations were modified to reflect the grading and reported basin storage capacity in the design plans. ARFs and WRFs were added to represent buildings and roughness values were changed to reflect development. The Project conditions model was run over the same 25-year and 100 -year peak flow hydrographs as the Existing conditions model and the model output was used to map and evaluate the changes in mudflow depths and velocities. Mudflow depths represent the maximum depth during the simulation and not the water-surface elevation at the end of the simulation. 2.6. I 11; 1 TETRA TECH Sopris Engineering, LLC 29 PROJECT CONDITIONS MODEL RESULTS The proposed design modeled under project conditions prevents debris from impacting most buildings (Figure 20). The debris flow basins contain sufficient storage capacity and are oriented to capture debris when the 60” culverts working effectively. Specifically, the basin receiving Inflow Sources 2 and 3 does not expand east far enough to capture all debris. This can mostly be attributed to a sharp western turn in the drainage channel above the study site. Model results show the 25-yr event jumps its banks at this turn and travels south onto the study site. While the basin is oriented to capture most debris, building C4 is impacted along its northern edge by debris flows depths of less than 1 ft. It is recommended that the upstream side and building be constructed to withstand debris flows. As discussed later, this should include a 3-foot freeboard based on FEMA criteria. Model results show the small building between A1 and A5 may be vulnerable to flooding from the basins to its west and north. While the building is dry in these model results, it is on the edge of a basin and directly below another. Finally, the channel planned on the far east edge of the property reduces the number of flow paths from three under Existing conditions down to two under Project conditions. Model results show this channel protects structures along the eastern edge of the property. There is a small stormwater swale along the uphill side of building B5 which was not included in the model. Inflow Source 5 is produces debris flows with depths of less than 1 foot along the uphill side of building B5. Similar to Existing conditions, debris flow velocities are relatively mild under Project conditions (Figure 21). Velocities from Inflow Sources 1, 2, and 3 generally decrease after the proposed development, while velocities from Inflow Sources 4, 5, and 6 increase, especially in the eastern channel. At the 100-year event, the flow patterns are similar to the 25-year event (Figure 22). There is substantially more flooding across the neighboring property to the east compared to existing conditions, however the flood extents are less compared to the 100-year existing conditions. Under both the 25- and 100-year conditions, the volume of flow out of the southern boundary of the project is less under Project conditions compared to Existing conditions (Table 9). In other words, the model predicts less mudflow onto the frontage road (and potentially I-70) under Project conditions compared to Existing conditions. Table 9. Summary of flow volume leaving study site for the 25- and 100 -year events (acre-feet) Inflow Source 25-Year Existing Conditions Outflow Volume 25-Year Project Conditions Outflow Volume 25-Year Change in Outflow Volume 100-Year Existing Conditions Outflow Volume 100-Year Project Conditions Outflow Volume 100-Year Change in Outflow Volume 1 9.41 9.11 -0.3 15.62 15.05 -0.57 2 and 3 1.47 1.4 -0.07 1.71 1.7 -0.01 4 1.88 1.65 -0.23 2.92 2.68 -0.24 2.6.1. 111:: I TETRA TECH Sopris Engineering, LLC 30 5 and 6 0.78 0.58 -0.2 1.04 0.88 -0.16 111:: I TETRA TECH Sopris Engineering, LLC 31 Figure 20. Predicted maximum mudflow depth for the 2-hour 25-year rainfall event under Project conditions. Wall --Debris C ulverts [ "11:: I TETRA TECH D Basins --Stormwater C ul verts -Concrete D Pro j ect Footprin t -Buildings • • • • Gr avel -Inflows 111:: I TETRA TECH 0 .10 -0 .50 0 .51 -1.00 -1.0 1-2 .00 -2.0 1 -3.00 -3.0 1 -5.00 -5.0 1 -7 .00 -7.01 -10.00 -10 .01 -27 .7 8 8 0 325 650 Feet Sopris Engineering, LLC 32 Figure 21. Predicted maximum mudflow velocity for the 2-hour 25-year rainfall event under Project Conditions. I "11: I TETRA TECH I 11; I TETRA TECH D Basins D Pro je ct Fo otprint -Inflows -Stormwater Culverts -Bui ldings -Concrete ····Grave l 0 325 650 Feet Sopris Engineering, LLC 33 Figure 22. Predicted maximum mudflow depth for the 2-hour 100-year rainfall event under Project conditions. --Debris Culverts I "11:: I TETRA TECH D Basins D Project Footprint -Stormwater Culverts -Bu ildings -Inflows I 11; I TETRA TECH -Concrete ····Gravel 0 .10-0.50 0 .51 -1 .00 1.01 -2.00 2 .01 -3 .00 3 .01 -5 .00 5 .01 -7 .00 7 .01 -10.00 0 325 650 Feet Sopris Engineering, LLC 34 Figure 23. Predicted maximum mudflow depth for the 2-hour 100-year rainfall event under Project conditions. I '11:: I TETRA TECH I 11; I TETRA TECH D Basins D Project Footprint -Inflows --Stormwater Culverts -Bu ild ings -Concrete ····Gravel 8 0 325 650 Feet Sopris Engineering, LLC 35 RECOMMENDATIONS The FLO-2D output was used to develop design recommendations which are based on FEMA design guidelines (2012). The following are general recommendations for mudflows. Building penetrations such as a windows or doors should be set with freeboard above the design mudflow depth. A minimum of 3 feet of freeboard is typically recommended by FEMA for surging waves which would include all walls that will have direct impact forces from mudflow and debris (Table 10 ). A minimum of 2 feet of freeboard is typically recommended for all walls with minor surging such as walls impacted by mud flows moving laterally, or that are in the shadow of up-fan buildings (Table 10). Table 10. Freeboard and Safety Factor Recommendations (copied from FEMA 2012) If the design depth cannot be achieved, then impact resistant glass could be considered for windows with the capabilities to withstand the required static and dynamic forces as discussed below. In the case of doors and garage doors, two conditions should be considered if the design depth cannot be achieved. First, the door should be designed for static and dynamic loading and include provisions for seepage; secondly, there should be an alternative exit for people to leave the building. Based on the results of this analysis, debris flow is most likely to affect buildings C4, B5, and the small building between A1 and A5 under Project conditions. As such, walls are recommended along the northern edges of C4 and B5, and the northern and western edge of the small building between A1 and A5. Based on discussion with Sopris Engineering, they will design a series of steel columns driven vertically into the channel bed on the upstream side of the culverts that will trap larger sediments transported and prevent them from being transported culvert while allowing water to continue to flow down the channel. Further, the steel columns will also be installed along the eastern channel to form a series of mini basins to store sediment. Frequent inspection and cleaning of the debris basins is recommended to maintain capacity. 3. Freeboard and Factor of Safety Recommendations Type of Flooding Freeboard (ft) Factor of Safety ShallCMI wa er flooding , <1 ft (RA M Zones A and B) 1 1.10 Moderate water fl oodin g, < 3 ft 1 1.20 Moderat e wa, er flood ing, < 3 ft w ith poten ial for 1 1.20 debri s rocks < 1 ft d iameter sediment Mud floods debris fl ooding < 3 ft, m inor surging 2 1.25 and deposition, < 1 ft boulders M ud f1 CM1s , debris flows < 3 ft , surg ing mud levees, 2 1.40 > 1 ft bou lders, m inor waves , deposition Mud and debri s f1CM1s > 3 ft , su rging, waves 3 1.50 boulders > 3 ft major deposition I 11; 1 TETRA TECH Sopris Engineering, LLC 36 REFERENCES Advanced Drainage Sytems, Inc. (ADS), 2017. N-12 Pipe Brochure. City of Aspen, 2014. Urban Runoff Management Plan. November. Federal Emergency Management Agency (FEMA), 2012. Engineering Principals and Practices for Retrofitting Flood-Prone Residential Structures. Appendix D – Alluvial Fan Flooding. FLO-2D, Pro, 2014. FLO-2D Software, Inc. Nutrioso, Arizona. Garfield County, 2020. Land Use and Development Code. Garfield County, CO. National Research Council, 1982. “Selecting a methodology for delineating mudslide hazard areas for the National Flood Insurance Program.” National Academy of Sciences report by the advisory Board on the Built Environment, Washington, D.C. Natural Resources Conservation Service (NRCS), 2012. National Engineering Handbook Part 630 Hydrology. Chapter 14 Stage Discharge Relations. United States Department of Agriculture, Washington, D.C. O’Brien, J.S., 2004. Simulating Mudflow Guidelines. Guidelines provided with FLO-2D model. Simons, Li and Associates, Inc. (SLA) and O’Brien, J.S., 1989. Flood Hazard Delineation for Cornet Creek, Telluride, Colorado. Submitted to the Federal Emergency Management Agency, Region VIII, March. Sopris Engineering, LLC, 2021. Existing Conditions Design. “19137 EXISTING SURFACE.dwg”. Sopris Engineering, LLC, 2022a . Final Project Conditions Design.“19137 DESIGN 22 -03- 18.dwg”. Sopris Engineering, LLC, 2022b. Site Layout. “19137 C2.0 OVERALL SITE PLAN.pdf”. 4. I "11:: I TETRA TECH NWP-39 U.S. Army Corps Application And Consultation SME Environmental Pre-Construction Notification, Nationwide Permit 39 April 2022 Royal Mini Storage West Glenwood (SME# 190050) SME Environmental, Inc. ATTACHMENT 1 Figures 0LOH 6RXUFHV 2SHQ6WUHHW0DS DQG FRQWULEXWRUV&&%<6$(VUL+(5(*DUPLQ1*$86*6136$5($2)'(7$,/ 3URMHFW$UHD )HHW (DVWQG$YH8QLW('XUDQJR&RORUDGR ZZZVPHHQYFRP 'RFXPHQW3DWK 6 ?3URMHFWV? :HVW*OHQZRRG6SULQJV593DUN?*,6?:HVW*OHQZRRG6SULQJV593DUN$UF3UR?:HVW*OHQZRRG6SULQJV593DUN$UF3URDSU[ &RRUGLQDWH6\VWHP 1$' 6WDWH3ODQH&RORUDGR6RXWK),36)HHW ),*85( 1$7,21:,'(3(50,7 52<$/0,1,6725$*(:(67 */(1:22' *$5),(/'&2817<&2 52$'9,&,1,7<0$3 6FDOH 1$ 5VYG'DWH 'DWH 3URMHFW1R 6% 5YZGE\ .% 'UDZQE\ BLM Colorc1do Rrver \/alley Field Office New C:is tle D ENVIRONMENTAL CONSULTANTS 67250.,1*02817$,1*/(1:22'635,1*6352-(&7 /2&$7,21 352-(&7/2&$7,21 7RZQVKLS6RXWK5DQJH :HVW3DUWVRI//6:1( DQG6(1(TXDUWHUVRI6HFWLRQ WK3ULQFLSDO0HULGLDQ *DUILHOG&RXQW\&RORUDGR 6XUYH\$UHD&HQWURLG 1$' /DWLWXGH /RQJLWXGH 86*67RSRJUDSKLF4XDGUDQJOH 3URMHFW$UHD )HHW6RXUFHV :RUOG7RSRJUDSKLF0DS (VUL+(5(*DUPLQ)$212$$86*6(3$13686$B7RSRB0DSV &RS\ULJKW 1DWLRQDO*HRJUDSKLF6RFLHW\LFXEHG (DVWQG$YH8QLW('XUDQJR&RORUDGR ZZZVPHHQYFRP 'RFXPHQW3DWK 6 ?3URMHFWV? :HVW*OHQZRRG6SULQJV593DUN?*,6?:HVW*OHQZRRG6SULQJV593DUN$UF3UR?:HVW*OHQZRRG6SULQJV593DUN$UF3URDSU[ &RRUGLQDWH6\VWHP ),*85( 1$7,21:,'(3(50,7 52<$/0,1,6725$*(:(67 */(1:22' *$5),(/'&2817<&2 7232*5$3+,&/2&$7,210$3 6FDOH 1$ 5VYG'DWH 'DWH 3URMHFW1R 6% 5YZGE\ .% 'UDZQE\ ENVIRONMENTAL CONSULTANTS 6RXUFHV *RRJOH(DUWK DFTXLUHG6HSWHPEHU (VUL+(5(*DUPLQ)$286*6(3$136'RFXPHQW3DWK 6 ?3URMHFWV? :HVW*OHQZRRG6SULQJV593DUN?*,6?:HVW*OHQZRRG6SULQJV593DUN$UF3UR?:HVW*OHQZRRG6SULQJV593DUN$UF3URDSU[)LJXUH,PSDFWV0DS/DQGVFDSH &RRUGLQDWH6\VWHP 1$' 6WDWH3ODQH&RORUDGR&HQWUDO),36)HHW $48$7,&5(6285&(6,03$&760$3 1$7,21:,'(3(50,7 52<$/0,1,6725$*(:(67 */(1:22' *$5),(/'&2817<&2 LQ IW .% 6% 6XUYH\DUHDERXQGDU\FUHDWHGE\60((QYLURQPHQWDO,QF 60( EDVHGRQGDWDIURP6RSULV(QJLQHHULQJ//&DQGSDUFHOGDWDIURP*DUILHOG&RXQW\*,6 60((QYLURQPHQWDO,QF 60( VWDIIYLVLWHGWKHVLWHRQ1RYHPEHU WRDVVHVVDQGGHOLQHDWHWKHERXQGDULHVRIWKHZHWODQGVDQGRWKHU:DWHUVRIWKH86 :286 LQWKHDUHDRILQWHUHVWXVLQJWKHPHWKRGRORJ\GHILQHGLQWKH5RXWLQH'HWHUPLQDWLRQSURFHGXUHVHWIRUWKLQWKH86$UP\&RUSVRI(QJLQHHUV:HWODQGV 'HOLQHDWLRQ0DQXDO 86$&( WKH5HJLRQDO6XSSOHPHQWWRWKH&RUSVRI(QJLQHHUV:HWODQG'HOLQHDWLRQ0DQXDO $ULG:HVW5HJLRQ 86$&(D DQG $)LHOG*XLGHWRWKH,GHQWLILFDWLRQRIWKH2UGLQDU\+LJK:DWHU0DUN 2+:0 LQWKH$ULG:HVW5HJLRQRIWKH:HVWHUQ8QLWHG6WDWHV 86$&(E 7KHERXQGDULHVRIZHWODQGVDQGRWKHU:286ZHUHVXUYH\ORFDWHGXVLQJD$QDWXP$UURZ*36XQLW $QDWXP*HRPRELOH6ROXWLRQVVXEPHWHUDFFXUDF\ $UHDVZKLFKOLNHO\VDWLVI\WKH86$&(FULWHULDDVZHWODQGVDQGRU:286DUHODEHOHG1RWHWKDW:286FRQWLQXHEH\RQGWKHSURMHFWDUHDERXQGDU\ $TXDWLFUHVRXUFHLPSDFWWDEOHUHSUHVHQWVDFUHDJHVVTXDUHIHHWOLQHDUIRRWDJHVDQGFHQWURLGORFDWLRQV 1$'6WDWH3ODQH IRUWHPSRUDU\DQGSHUPDQHQW LPSDFWVSURSRVHGXQGHU1DWLRQZLGH3HUPLW 3OHDVHEHDZDUHWKDWLPSDFWVWR:286PD\UHTXLUHDXWKRUL]DWLRQIURP/RFDO6WDWHDQGRU)HGHUDOUHJXODWRU\DJHQFLHV7KHOLPLWVRILPSDFWVWRMXULVGLFWLRQDO ZHWODQGVDQGRWKHU:286VKRZQKHUHRQDUHEDVHGXSRQFXUUHQWSODQVDQGUHQGHULQJVIRUVXEPLVVLRQWRWKH86$&(IRU1DWLRQZLGH3HUPLW UHTXHVW $QFLOODU\LPSURYHPHQWW\SHVOD\RXWVDQGSURSRVHGXVHVPD\YDU\VRPHZKDWDVORQJDVWKHQDWXUHDQGVFRSHRILPSDFWVWRZHWODQGVDQGRWKHU:286LVQRW FKDQJHG*(1(5$/127(6 (DVWQG$YH8QLW('XUDQJR&RORUDGR ZZZVPHHQYFRP ),*85( 'UDZQE\ 'DWHGUDZQ 5YZGE\ 'DWHUYVG 6FDOH 3URM1R IK>EBFBG:KR3GHM?HK<HGLMKN<MBHG HK K><HK=BG@ 7 3 3 7 3 7 333 7 $ % & ]^$ 352-(&7 /2&$7,21 *DUILHOG&RXQW\ PL IW %/0 $PL V$FUHV &DPSJURXQG &RORUDGR5LYHU 3URMHFW$UHD $TXDWLF5HVRXUFHV (SKHPHUDO 5 $TXDWLF5HVRXUFHV,PSDFWV 3HUPDQHQW 7HPSRUDU\ 6RSULV'HVLJQ 3URSRVHG6WRUP3LSH ([LVWLQJ6WRUP,QOHW 3URSRVHG*UDYHO 3URSRVHG$VSKDOW&RQFUHWH 3URSRVHG&RQWRXU ([LVWLQJ&RQWRXU 3URSRVHG:DWHU7DQN%HQFK 3URSRVHG%DVLQ 3URSRVHG%XLOGLQJ 3URSRVHG9DOOH\3DQ ,PSDFW $UHD $TX5HV $UHD $TX5HV 7\SH $FUHV 6TXDUH )W /LQHDU )W&HQWURLG<&HQWURLG; 3$(SKHPHUDO 5 3%(SKHPHUDO 5 3&(SKHPHUDO 5 727$/ $FUHDJHWRWDOEDVHGRQVXPRIVTXDUHIHHWQRWVXPRIDFUHDJHV ,PSDFW $UHD $TX5HV $UHD $TX5HV 7\SH $FUHV 6TXDUH )W /LQHDU )W&HQWURLG<&HQWURLG; 7$(SKHPHUDO 5 7%(SKHPHUDO 5 7&(SKHPHUDO 5 727$/ $48$7,&5(6285&(63(50$1(17,03$&767$%/( $48$7,&5(6285&(67(0325$5<,03$&767$%/( $TXDWLF5HVRXUFH$UHD$SDUWLDOO\VSOLWOHQJWKZLVHE\WHPSRUDU\DQGSHUPDQHQW LPSDFWV6XPRIOLQHDUIHHWRI$LPSDFWVH[FHHGVWKHWRWDOOHQJWKRI$UHD$ ENVIRONMENTAL CONSULTANTS -■■-■■ : I .... -.. D D D ' I ' I I I ' I AT I U ]^$ 7KH KDELWDW OD\HUV GHSLFWHG LQ OHJHQGUHSUHVHQWGDWDSURYLGHGE\ &3: DQG &2*&& ZKLFK ZHUH XVHG WR SUHSDUHWKLVPDS$Q\OD\HUVQRW VKRZQ DUH QRW ORFDWHG LQ WKH PDSSHGDUHD6RXUFHV 'LJLWDO*OREH$HULDO,PDJHU\DFTXLUHG :RUOGB,PDJHU\ 0D[DU )HHW 'DWH 5VYG'DWH 1$ 6FDOH 'UDZQE\ .% 5YZGE\ 6% 3URMHFW1R (DVWQG$YH8QLW('XUDQJR&RORUDGR ZZZVPHHQYFRP 1$7,21:,'(3(50,7 52<$/0,1,6725$*(:(67 */(1:22' *$5),(/'&2817<&2 ),*85( %$/' *2/'(1($*/(+$%,7$70$3 'RFXPHQW3DWK 6 ?3URMHFWV? :HVW*OHQZRRG6SULQJV593DUN?*,6?:HVW*OHQZRRG6SULQJV593DUN$UF3UR?:HVW*OHQZRRG6SULQJV593DUN$UF3URDSU[ &RRUGLQDWH6\VWHP 1$' 6WDWH3ODQH&RORUDGR6RXWK),36)HHW 6XUYH\$UHD %DOG(DJOH+DELWDW :LQWHU5DQJH :LQWHU)RUDJH 6XPPHU)RUDJH 5RRVW6LWH îPL%XIIHU 1HVW6LWH íPL%XIIHU ii~ ENVIRONMENTAL CONSULTANTS Pre-Construction Notification, Nationwide Permit 39 April 2022 Royal Mini Storage West Glenwood (SME# 190050) SME Environmental, Inc. ATTACHMENT 2 Plansets Prepared by Sopris Engineering, LLC. 5780575 0 57 8 0 5750 5760 5770 57205730574057305720571057 3 0 57 2 0 5710 57405730 5770 5790 5780 5760 5770 5790 5800 57605770 57905800 5690 5690 5748 5746 574 4 5738 5764 5768 5770 57705760576057805800 5794 5784 5776 5794 5760 5770 5750 5790 5792 57 9 0 5798 57705746 5780 ue ueueueue ue ue ue ue ue ueueueoe oe oe oe oe oe oeoeBUREAU OF LAND MANGEMENT STORM KING HUNTING RANCH LLC REC. # 658533 RICHARD DEVER REC. # 570056 BURIED ELECTRICAL LINE30' ACCESS AND UTILITY EASEMENT 10' MTN STATES TELEPHONE EASEMENT ELECTRIC VAULT ELECTRIC TRANSFORMER 12X16' WELL BUILDING DEVER WELL #1 EXISTING LEECH FIELD EXISTING RESIDENTIAL STRUCTURE BURIED PROPANE TANK FIRE HYDRANT WELL BUILDING 12X13' DEVER WELL #3 30' ACCESS EASEMENT 14' POWERLINE EASMENT 18' POWERLINE EASEMENT PARCEL A 24.42 ACRES ± PARCEL B 14.48 ACRES ± AMICHAUX LIMITED PARTNERSIP LLLP HIGHWAY 6&24 INTERSTATE 70 WEST BOUND EXISTING CULVERT EXISTING CULVERT EXISTING CULVERT EXISTING CULVERT EXISTING CULVERT EXISTING CULVERT EXISTING CULVERT 150' STOCK DRIVE WAY EASEMENT OVERHEAD ELECTRICAL LINE OPRIS ES NGINEERING, LLC. CIVIL CONSULTANTS 19137.01JOB NO. DATE: 502 MAIN STREET CARBONDALE, CO 81623 (970) 704-0311 FAX: (970)-704-0313 DESIGNED BY DRAWN BY CHECKED BY AD AD YN DATE REVISION C-1.0 DRAWING NO. TITLE G:\2019\19137\CIVIL\CIVIL DWGS\PLOT\LIMITED IMPACT REVIEW\19137 C1.0 EXISTING CON.DWG - Mar 31, 2022 - 1:15pmNORTHEXISTING CONDTIONSROYAL MINI STORAGE AT WEST GLENWOODGARFIELD COUNTY, COLORADOLIMITED IMPACT REVIEW1 inch = ft. ( IN FEET ) GRAPHIC SCALE 075 75 150 75 30037.5 MEMBER UTILITIES FOR THE MARKING OF UNDERGROUND BEFORE YOU DIG, GRADE, OR EXCAVATE CALL 2-BUSINESS DAYS IN ADVANCE .QRZZKDW V 5 04-15-22 02/11/22 02/11/22 04/15/22 PROPERTY LINE PROPERTY LINE PROPERTY LINEPROPERTY LINE PROPERTY LINEPROPERTY LINEC below all before you· d' 19. xxxxxxxxA1 A2 A3 A4 A5 A6 A7 OUTDOOR STORAGE EXISTING LEECH FIELD EXISTING WELL PROPERT Y L I N E PROPERTY LINE PROPERTY LINE PROPERTY LINE PROPERTY LINE PROPERTY LINEC1 C2 C3 C4 EMPLOYEE HOUSING OFFICE EXISTING HOME WESTBOUND INTERSTATE 70 HIGHWAY 6&24 C5 B1 B2 B3 B4 B5 B6 B7 B8C2.1OPRISESNGINEERING, LLC. CIVIL CONSULTANTS 19137.01JOB NO. DATE: 502 MAIN STREET CARBONDALE, CO 81623 (970) 704-0311 FAX: (970)-704-0313 DESIGNED BY DRAWN BY CHECKED BY AD AD YN DATE REVISION C-2.0 DRAWING NO. TITLE G:\2019\19137\CIVIL\CIVIL DWGS\PLOT\LIMITED IMPACT REVIEW\19137 C2.0 SITE PLAN.DWG - Mar 31, 2022 - 1:18pmNORTHOVERALL SITE PLANROYAL MINI STORAGE AT WEST GLENWOODGARFIELD COUNTY, COLORADOLIMITED IMPACT REVIEW1 inch = ft. ( IN FEET ) GRAPHIC SCALE 075 75 150 75 30037.5 MEMBER UTILITIES FOR THE MARKING OF UNDERGROUND BEFORE YOU DIG, GRADE, OR EXCAVATE CALL 2-BUSINESS DAYS IN ADVANCE .QRZZKDW V 5 SHT C2.3 SHT C2.2 SHT C2.4 SHT C2.1 C-2.1 C-2.2 C-2.3 C-2.4 04-15-22 02/11/22 02/11/22 04/15/22 / r I I -- -u " • - I 1 \ " / I / / ~ I ~ I \ \ 'I / I!\ \ -- below. Call before you dig. xxx >>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>> >>>>>>>>>>>>>>>>>>>>>>>>>>>>>>> >>>>>>>>>>>>>>>>>>>> x xxxxxx xxxxxPROPOSED SECURITY GATE OFFICE BUILDING EMPLOYEE HOUSING CARPORT SPACE FOR EMPLOYEE HOUSING PROPOSED FENCE BETWEEN BUILDINGS A1 A2 A3 A4 A5 A6 A7 HIGHWAY 6&24 R25' 200' 200' 240' 120' 120' 200' 200' 30' 40' 30' 23' 23' 23' 30' 40' 30' 40' 40' 36' 23' 24' 24' R20' R20' R5'R5' R25' 40' 40' 23' 23' 12' 17' BASIN 3C BASIN 3D OPRIS ES NGINEERING, LLC. CIVIL CONSULTANTS 19137.01JOB NO. DATE: 502 MAIN STREET CARBONDALE, CO 81623 (970) 704-0311 FAX: (970)-704-0313 DESIGNED BY DRAWN BY CHECKED BY AD AD YN DATE REVISION C-2.1 DRAWING NO. TITLE G:\2019\19137\CIVIL\CIVIL DWGS\PLOT\LIMITED IMPACT REVIEW\19137 C2.0 SITE PLAN.DWG - Mar 31, 2022 - 1:18pmNORTHSITE PLAN PHASE 1ROYAL MINI STORAGE AT WEST GLENWOODGARFIELD COUNTY, COLORADOLIMITED IMPACT REVIEW1 inch = ft. ( IN FEET ) GRAPHIC SCALE 020 20 40 20 8010 MEMBER UTILITIES FOR THE MARKING OF UNDERGROUND BEFORE YOU DIG, GRADE, OR EXCAVATE CALL 2-BUSINESS DAYS IN ADVANCE .QRZZKDW V 5 SHT C2.3 SHT C2.2 SHT C2.4 40' 30' 04-15-22 02/11/22 02/11/22 04/15/22 3' VALLEY PAN (TYP) SWALE (TYP)0 I» -CJ" ~er cil !!!. '<0 g :e C. a:, --/ ---I I I I I I I I I I I I I I I I I I I I I \~ I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I •. t,. ,. 1 ..... \ .. . . . . -~ •• . . • •• .. 11·' • I • • • • .. •• •• ' • • • • K • • • • ·, • • • • • • • • • • • • .. .. • • • • • • • • • & • t ' 1( \ "-......... ---• •• +-. . ·'!· " .•.. 7 • • • . . • 1 • ' . • • • • • .. • • • • • • .. • • • • . " •• • • • • • •. .. • • .. • • • ,· .. • _t,.o. ..-... t,. t,. .. t,. t,. . . . . . . • • • • ~ .. .. . .. .... .. ... I • • '· • • • • • . . l>t,. b. .. t,. • •• • • ' • • • • • •I • • • • • • • " . · • • • • • • • • •' • •• • ·, • •• • .. • • • • • • • • • ~ • •• . .. • I• • '· L\._t,.· • .. . .. , • .. .. • • . ~ • • • • • • • • • •• •• • • • • • • • • • • . • • ' • . .. • • • • • • • I!,. ""' • , • • ' !------;. • • .. •• ' • • • • . •. ·.1.J----7 • .. • • • • •• • • • • • & • ' • . ., • • • • . ... • • • • • • • • . • ••• • • • • •, -/ "' I I I I I I i---___,-'-I • • • • . I . .. .. .. .. .r,. ~ ... -. . ~ • • -f I I I --=+-J • • • • •• • . • • • • • ,, •• • • • • • • • •• • • • • • • • • • • • • .; 'I':>• • • "'c,. • • • • e • • •• • , .... t,. • • • • ,,_!::; "'••. • • • • • . ' .. • •• • • • \ \ \ \ \ \ " • • •• ' -----' • ,. • • I• • • • • .. • • • • • • • • ~ • • •, • • • • • -.. r,,. . • •I • b.l"' • • • • -C> "! • • • • .. • • • • • • .I I \ : • .. •• •• • • • • • • • • • • •• ·. • . .. • • • • . . • • • • .. .. : t,. • . • • • • • • • • • • • • • • ••• • • ~ •· " . • • • •• • • .... ,. ' • • • • • ·L-----1 • • • • ·• • • • •• \ --1 I \ , • • ' . • ' •• •• • .. • • • • •I • ' • • • • • • . •, • • • • • •• • •• • • . • . • • • • • ' • • • • • •• • . • • • • • • • • • • • • ~ .. ,,. ·~ • • • • .. • • • • • • • • • •• • • " • • • I \. • • • ·, • • • • '(._---, • • • • • • • • • l \ \ ~ • . . ' •• \ I I I \ • • • • • • • • • ' • .. " • • • ,. • • • • • • ,. ·i,. 4 .. " •• • . . • • \ \ \ \ ~ I I I I I I I I I I I '-.. J -I r,.. ' Ill I . ~. ·. t _:-c-1: 7""",. r-1 -. ----:_ .-.___....J.l I . • • • • • • • • • . • • ., • • • . t,.' • • . • .. • • • •I • • • • .. '• • • • • • .. o.i,.4 • . . • • • • • • • • • . • • • • • • •• " . . . ~ ,.. ~ ,r,. •• • • • •• • • • • •• • • • .. ~~ ' • • • • • • • . • .. • • • • •. • • • .. • • ••• • ...... • • t • • • "i ... ~ • • • • • ·. • • ,. • • • • • • . . ,• • I•• • • • ·• • • • • • • .. • • .• • •• • I I I I I I I I I I I I I I I I I I I .\ ~ ------......... I ~ I I / -........ "' /-/ \ ~ I \' \ ,, '· u "ij HWY 6 >>>>>>>>>>>>>>> >>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>x x x xxxxxxxxxPROPERTY LINE PROPERTY LINE200' 200' 160' 160' 200' 40' 40' 23' 23' 23' 30' 40' 40' 30' 40' 40' 40' 40' 40' 40' 30' 200' 200' 200' 3' VALLEY PAN 3' VALLEY PAN 3' VALLEY PAN B1 B2 B3 B4 B5 B6 B7 B8 SWALE (TYP) FENCE BETWEEN BUILDINGS (TYP) STORM WATER DETENTION HWY 6 I-70 I-70 EMPTY FIBER CONDUITS oe8''WL8''WL8''WL>>>>>>>>>>OPRIS ES NGINEERING, LLC. CIVIL CONSULTANTS 19137.01JOB NO. DATE: 502 MAIN STREET CARBONDALE, CO 81623 (970) 704-0311 FAX: (970)-704-0313 DESIGNED BY DRAWN BY CHECKED BY AD AD YN DATE REVISION C-2.2 DRAWING NO. TITLE G:\2019\19137\CIVIL\CIVIL DWGS\PLOT\LIMITED IMPACT REVIEW\19137 C2.0 SITE PLAN.DWG - Mar 31, 2022 - 1:21pmNORTHSITE PLAN PHASE 2ROYAL MINI STORAGE AT WEST GLENWOODGARFIELD COUNTY, COLORADOLIMITED IMPACT REVIEW1 inch = ft. ( IN FEET ) GRAPHIC SCALE 020 20 40 20 8010 MEMBER UTILITIES FOR THE MARKING OF UNDERGROUND BEFORE YOU DIG, GRADE, OR EXCAVATE CALL 2-BUSINESS DAYS IN ADVANCE .QRZZKDW V 5 SHT C2.3 SHT C2.1 SHT C2.4 04-15-22 02/11/22 02/11/22 04/15/22 • • • 4 • • 4 • 4 • 4 • • • 4 • • 4 • . • • - • • • • • • • • • • 4 • • • • • 4 4 y • • • • • . . • • 4 • . . • - . . • • • . . • •• . . • - . . . 4 " ., ;, •• • • 4 • 4 4 • 4 • 4 • • • • • • - • • • • • • . 4 • . . • • • • 4 • • 4 • • • • • • 4 • • • • • • • • • • • • • • • • • 4 • • • •• • 4 • 4 . . • • • 4 , • • • . . • • 4 4, 4 • • • • • • 4 • • 4 • • • • • 4 • 4 • • • • • • • • • A • ., • 4 • . . . • 4 • • • • • . . . . • \.· J • • • 4 • • 4 4 - • • • "'·"-ll • . . • 4 - • • - , • • 4 • ' • • 4 • • 1 -- • • • 4 • ' 4 ". LI • • • • • • .. - ' ' • • • • 4 .. • • • • • • • • 4 .. 4 • • • - J • • • • • . • • 4 4 • • • • • - • ·• 4 • • 4 I • • • • • • • • • • • I ( I I I I I I I I I I \,. -- 1 1 - \ I I I I I I I I I ) I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I ~---c_ __ _ below. Call before you dig. EMPTY FIBER CONDUITS>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>> >xxxxxxxxxxxxx x xxxxxxx xUEUEUEUEUER20' R20' PROPERTY LINE PROPERTY LINE PROPERTY LINE C1 C2 C3 C4 C5 280' 280' 240' 40' 40' 160' 160' 40' 30' 30' 40' 40' R20' R20' 23' 23' 23' DEBRIS BASIN 2 40' 40' 3' VALLEY PAN (TYP) R20' R20' 24' 24' FENCE (TYP) HWY 6 I-70 I-70 EMPTY FIBER CONDUITS oe8''WL8''WL8''WL>>>>>>>>>>OPRIS ES NGINEERING, LLC. CIVIL CONSULTANTS 19137.01JOB NO. DATE: 502 MAIN STREET CARBONDALE, CO 81623 (970) 704-0311 FAX: (970)-704-0313 DESIGNED BY DRAWN BY CHECKED BY AD AD YN DATE REVISION C-2.3 DRAWING NO. TITLE G:\2019\19137\CIVIL\CIVIL DWGS\PLOT\LIMITED IMPACT REVIEW\19137 C2.0 SITE PLAN.DWG - Mar 31, 2022 - 1:22pmNORTHSITE PLAN PHASE 3ROYAL MINI STORAGE AT WEST GLENWOODGARFIELD COUNTY, COLORADOLIMITED IMPACT REVIEW1 inch = ft. ( IN FEET ) GRAPHIC SCALE 020 20 40 20 8010 MEMBER UTILITIES FOR THE MARKING OF UNDERGROUND BEFORE YOU DIG, GRADE, OR EXCAVATE CALL 2-BUSINESS DAYS IN ADVANCE .QRZZKDW V 5 SHT C2.1 SHT C2.4 SHT C2.2 04-15-22 02/11/22 02/11/22 04/15/22 SWALE (TYP)0 I» CJ" ~er cil !e. '<0 g :E C. a:, • • • • • " , •. • • • • " ' • •• • • • " • ' • ~ •· • • . • ·,. (;. • •• • • \ \ • •• \ " " ........... ---///, /, •. • • ...... • • ...... • • --: • I _./ -• • • • • ':. . • • . . •• • • • • • • • • • • • • ' • • • ~~ ,• • • • . • • • • . \ \ \ \ • • "• • • • • • • \ .. • • • • ' • • " •• • • • ,t,. .. • • • • • • • • • • • . ... ~ • • .,. • • • • . • • • ·t-· • • • • .. " • • •• . • • • • " • • " .. • • • . • •• • ~ • • • . •" • .. .. . • • • • • • • • • • • • • • • • • • • • • • • ~ • • • • • • • • " • .. • . • • . • • • • • •• • . • • • • ... • • • • • • • " • • • • ' t ~ • • • • • • • • • • • " •• • • .. • • • • • • • ' • ,, • ., • •• . •· • • • • • .• • t • • • •. " •" •• • • • • .. • • • .. t:,. .. l>D; • • • • '• • • . . • .. " •• • • " • • .. • • • • • • • ~ ':'-'1-•• • " .. •• ~ .. , • " • 6,1 .. • " . -\ .. • • • • • • • • • • .. ' •• •, • •• • .. • I, • .. • • ' • • • • • .. • • • ~ • ,, • '• • • • • • • • • • ~ • • • .. •• • • • • .. • ,. .. ,.e. • • • ., • • . •' .. < • .. " • ••• • • • • • . • • • • • • • • • • • • • ,. t, .. • • • t • • •• ~ • • • • • ~ ·" • • ' ·' • . • • .. • • • • • • • .. • • " • • . . . • • • • " • .. • • • • • • • • • • .• • • • .. • • • • • • • • • • • • • • • ' • 'o • • • • • • ' r,.+>' • • • • • • • • • ., • ,. ·• • • • • • • • • • • • • •· . .. .. " • • • • • • • • . .. . •,_ • • • \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ -/ \ \ \ \ \ \ \ \ -...... \ \ \ \ " \ \ \ \ \ \ \ . • . . • • . :· . / .• . '. I.. . ~. / \ " • • • • • • . ~ • • • • • • • • • • • • • >. • • • • ••• • • • • • • ~ • .. _. ❖ ... • • • • • • .1 _,..l ..1-C-. -t, i /'-t:, .... ts .. !,. • • • • • • • •. • • • • • • . " • • • . • 1:,,.-"" I"-t:, ... ., . ' • • • • • .. ~-• " ,. • • •• . . .. • • • •• t:..: . • • • • • • . • • •• •• . • • ' ·, • • • • ~ • .. ·•. • • • • • " •. • • • . • • • • • • • • • . • • • •• •• • • • ... /" .. .. t,, • • • 4 ._ .. • • " • I:> .. 4_ b • • • • • • • • • • • • .. • . • •' !-. .. • 1 ' ,• . \". :. . l: • • • . "' ... • • .. • • • " ~ L ' ~ • • • • " ' ' • • I •• _. / •. -~< • • • • • • • < • .. I ·'' \ • \ ··~~ ·.-.. \ \ . . ·. \ \ . . \ " --. .. [;. • • • -----' • •·· • • • • • ,.t:,.· • • ., • • ~ • • .• • • • • " • _J • • • • . .• • •• •• • ..... •• .. • . , •• • \ \ \ \ \ \ \ '--/ l -\ \ \ \ \ I I I I I I \ \ \ I I I I I I I I \/ \ \ \ \ \ \ '" • • . \ . : l::. '1""" \ • • • • • • \ • t . • • • "; . • . \ . • • •• \. • • •. . • •• • ' . .. ~ • • • • • • • ' • • • ,· • • • . "' 0 • '~ .. • • • ~,. • I • • • • / • ~ • • b, ;,_4 ·• • • • • ... • • • • • .. .• • , . • • .. • • ..,.----------• • • • -\=~ \ \ \ \ \ \ \ u i§-1' ' ,On. \\_I I ,Bl'--\'F't "ij ) ~ ---- xxxxOUTDOOR STORAGE EXISTING LEECH FIELD EXISTING WELL EXISTING PROPANE TANK R25' R10' R20'R25' R20' R25' 278' 188' 10' 20' 20' 40' 24' PROPERT Y L I N E R20' DEBRIS BASIN 1 PROPOSED WALL FOR ROCKFALL MITIGATION EXISTING DRY HYDRANT DEBRIS BASIN 1 EXISTING HOUSE HWY 6 I-70 I-70 EMPTY FIBER CONDUITS OPRIS ES NGINEERING, LLC. CIVIL CONSULTANTS 19137.01JOB NO. DATE:04-15-22 502 MAIN STREET CARBONDALE, CO 81623 (970) 704-0311 FAX: (970)-704-0313 DESIGNED BY DRAWN BY CHECKED BY AD 02/11/22 AD 02/11/22 YN 04/15/22 DATE REVISION C-2.4 DRAWING NO. TITLE G:\2019\19137\CIVIL\CIVIL DWGS\PLOT\LIMITED IMPACT REVIEW\19137 C2.0 SITE PLAN.DWG - Mar 31, 2022 - 1:24pmNORTHSITE PLAN OUTDOOR STORAGEROYAL MINI STORAGE AT WEST GLENWOODGARFIELD COUNTY, COLORADOLIMITED IMPACT REVIEW1 inch = ft. ( IN FEET ) GRAPHIC SCALE 020 20 40 20 8010 MEMBER UTILITIES FOR THE MARKING OF UNDERGROUND BEFORE YOU DIG, GRADE, OR EXCAVATE CALL 2-BUSINESS DAYS IN ADVANCE .QRZZKDW V 5 SHT C2.3 SHT C2.1 SHT C2.2 30% SLOPE LINE \ 0 _/ - --~/ fr/ t I I I I \ \ \ \ \ \ \ \ \ \ \ \ \ \ j ! 0 i! ' ' rur, , -........ ........... ........... \ \ '\ '\ '\ '-......._ ......._ ......._ ........... --- ~ I I I I I below. ~ ----~~~ Callbeforeyoudig. oe oe oe oe oe oe oe oe oeoeUEUExxxxxxxxUEUEUEUEA1 A2 A3 A4 A5 A6 A7 B1 B2 B3 B4 B5 B6 B7 B8 PROPOSED DETENTION POND EXISTING LEECH FIELD EXISTING WELL C1 C2 C3 C4 OUTDOOR STORAGE EMPLOYEE HOUSING OFFICEEXISTING HOME WESTBOUND INTERSTATE 70 HIGHWAY 6&24 C5 OPRIS ES NGINEERING, LLC. CIVIL CONSULTANTS 19137.01JOB NO. DATE:04-15-22 502 MAIN STREET CARBONDALE, CO 81623 (970) 704-0311 FAX: (970)-704-0313 DESIGNED BY DRAWN BY CHECKED BY AD 01/28/22 AD 01/28/22 YN 04/15/22 DATE REVISION C-3.0 DRAWING NO. TITLE G:\2019\19137\CIVIL\CIVIL DWGS\PLOT\LIMITED IMPACT REVIEW\19137 C3.0 GRADING.DWG - Mar 31, 2022 - 1:28pmNORTHOVERALL GRADING PLANROYAL MINI STORAGE AT WEST GLENWOODGARFIELD COUNTY, COLORADOLIMITED IMPACT REVIEW1 inch = ft. ( IN FEET ) GRAPHIC SCALE 075 75 150 75 30037.5 MEMBER UTILITIES FOR THE MARKING OF UNDERGROUND BEFORE YOU DIG, GRADE, OR EXCAVATE CALL 2-BUSINESS DAYS IN ADVANCE .QRZZKDW V 5 3a 3b 3c 3d 2 ' ' ) ( 11 Iii\ 11\\\\\\ 1111 ((I( !/ J; I /--; _ _,, \ \\\/ 13/l!;;)Ji/;)J;IJ,;;l/;!/Jl;(I; I; j 1 1 1 I,,, __ J \\\\\ ll/j;,Jij;/;f!(;IJ;l((I/ !)I/ 11 _I ~,\\\\ --- \ below. Call before you dig. xxx >>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>> >>>>>>>>>>>>>>>>>>>>>>>>>>>>>>> >>>>>>>>>>>>>>>>>>>> x xxxxxx xxxxx5770 5790 5780 5770576057805800 5794 5770PROPOSED SECURITY GATE OFFICE BUILDING EMPLOYEE HOUSING CARPORT SPACE FOR EMPLOYEE HOUSING A1 A2 A3 A4 A5 A6 A7 HIGHWAY 6&24 FFE:5775.30' FFE:5774.80' FFE:5774.30'FFE:5773.80' FFE:5773.30' FFE:5775.30'FFE:5774.80'FFE:5774.30' FFE:5773.80'FFE:5773.30' FFE:5773.30'FFE:5773.80'FFE:5774.30'FFE:5774.80' FFE:5775.30'FFE:5775.82' FFE:5772.50' FFE:5771.50'FFE:5771.00'FFE:5770.50' FFE:5772.50' FFE:5772.00' FFE:5771.50' FFE:5771.00'FFE:5770.50' FFE:5772.64' FFE:5772.00' FFE:5771.50'FFE:5771.00' FFE:5770.55' FFE:5771.51' FFE:5771.04' FFE:5770.59' 1.0% 1.0% 1.0% 1.0% 1.0% 1.1% 1.0% 2.5% 2.5% 2.5% 2.3%57701.0% 1.0% 1.0% 1.0%1.0%2.0%-2.7:1-2.2:1-2.2:1-2.1:1-2.2:1-2 .3 :1-2.0:1-2 .0 :1-1.6:15760 5750 57 9 6 58 0 0 5804 5794 577457725780 57781.0%2.1%1.0%6.7% 6.7%0.1%6.7%0.0%1.0%1.3% 2.0% RIM:5774.24' RIM:5774.93' RIM:5774.37' RIM:5773.57' RIM:5773.30' RIM:5772.44' RIM:5772.11' RIM:5772.29' RIM:5771.60' RIM:5770.71' RIM:5771.37' RIM:5770.63' RIM:5770.61' RIM:5771.37'57605750577057765.5%5.7%7.8%0.2%5.8%0.0%1.0%1.0%1.0%1.0%1.0%1.0%3.1% 3.1% 2.1% DAYLIGHT: 5750.25' RIM:5775.17' RIM:5775.17' INV IN: 5794' INV OUT: 5774' INV IN: 5764.5094 LF OF 60" ADS N-12 SMOOTH WALLED PIPE @ 20.9%210 LF OF 60" ADS N-12 SMOOTH WALLED PIPE @ 6.8%12.0%10.7%3.7% 3.0% 5.5% 2.9% RIM:5771.09' 3.5% 3.8% 4.2% 1.0% 1.0%57705780 HWY 6 I-70 I-70 EMPTY FIBER CONDUITS OPRIS ES NGINEERING, LLC. CIVIL CONSULTANTS 19137.01JOB NO. DATE:04-15-22 502 MAIN STREET CARBONDALE, CO 81623 (970) 704-0311 FAX: (970)-704-0313 DESIGNED BY DRAWN BY CHECKED BY AD 01/28/22 AD 01/28/22 YN 04/15/22 DATE REVISION C-3.1 DRAWING NO. TITLE G:\2019\19137\CIVIL\CIVIL DWGS\PLOT\LIMITED IMPACT REVIEW\19137 C3.0 GRADING.DWG - Mar 31, 2022 - 1:35pmNORTHGRADING AND EROSION CONTROL PLANROYAL MINI STORAGE AT WEST GLENWOODGARFIELD COUNTY, COLORADOLIMITED IMPACT REVIEW1 inch = ft. ( IN FEET ) GRAPHIC SCALE 020 20 40 20 8010 MEMBER UTILITIES FOR THE MARKING OF UNDERGROUND BEFORE YOU DIG, GRADE, OR EXCAVATE CALL 2-BUSINESS DAYS IN ADVANCE .QRZZKDW V 5 SHT C2.3 SHT C2.2 SHT C2.4 30% SLOPE LINE I I I / / / I / / ----- / I / / - - I I / / / / I 1 ---'-I- l-t-- / I \ --- / / -- I 7 / ------- 1/1 /1 I I I I I I i /;1 1 I I I I I ) I I I ;I 1 I I ,1 1 I I ________ __....,.,,,.. /I I \ \ / I I I / I / \ /_ 7 / I / I I -r- / I I / I I I I / / / I / I / I / _;_ I I I / / / / / / I / / / / / I I / / / I / / / I I I / I / / / / I I / I I ---- ,,,----- I / / I I / / / I / / / I / I I / / • I I / I I • / I I I ----- . /. . / / I • . .,, / I I I /• • ,,,,,,----_ __., / / .,.,,,,.----/ 1 =~\=j '-..=:=;;:::::-;;;;=---~:::=::===s~~="==-~=~=~:==~=~==~:::=:/=:~\-~~;J,'-..~---_/--~~~.;;;..:.,,,~,,,::-1..,,,:::.~~,~'"::"'~--=======t\~~~~=~=,,..:::~:::~ I 0 • - • • • • / "./ below. Call before you dig. HWY 6 >>>>>>>>>>>>>>> >>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>x x x xxxxxxxxx5750 5760 5770 57205730574057405730 5748 5746 574 4 5738 5764 5768 5770 576057605746 5780 B1 B2 B3 B4 B5 B6 B7 B8 PROPOSED DETENTION POND PROPERTY LINE PROPERTY LINE2.5% 2.5% 2.3% FFE:5769.92'FFE:5769.20'FFE:5768.70' FFE:5768.20' FFE:5767.70' FFE:5766.90'FFE:5766.40' FFE:5765.90'FFE:5765.40' FFE:5764.90' FFE:5765.40'FFE:5765.90'FFE:5766.40' FFE:5766.90' FFE:5767.70' FFE:5768.20' FFE:5768.70' FFE:5769.20' FFE:5769.70' FFE:5769.70'FFE:5769.20' FFE:5768.70' FFE:5768.20' FFE:5767.70' FFE:5766.90' FFE:5766.40' FFE:5765.90'FFE:5765.40' FFE:5766.90'FFE:5766.40' FFE:5765.90'FFE:5765.40' FFE:5764.90' FFE:5769.70'FFE:5769.20' FFE:5768.70' FFE:5768.20' FFE:5767.70'57705750 57405768 5766576257605770 57561.0% 2.5% 2.5% 2.5% 1.0% 1.0% 1.0% 1.0% 1.1%1.0%1.0%1.0% 1.0%1.0%1.0%1.0%1.0%1.0%1.0%1.0%1.1%1.1%1.0% 1.0%1.0%1.0% 1.0%1.0%1.0%1.0%1.0%1.0%1.0%1.0%2.0% 2.0% 2.0%0.0%-2.1:1-2.1:1-2.0:1-2.1:1 -2.4:1 -2. 3 : 1-2.0:1-2.0:1-2.2:1RIM:5769.67' RIM:5769.29' RIM:5769.67' RIM:5769.29' RIM:5769.67' RIM:5768.69' RIM:5767.88' RIM:5766.75' RIM:5765.83' RIM:5764.78' RIM:5764.87' RIM:5764.87' RIM:5765.88'RIM:5766.69' RIM:5767.88' RIM:5768.67' RIM:5768.69' RIM:5767.88' RIM:5766.48' RIM:5766.63' RIM:5766.49' RIM:5765.88' 5770 5776 576857665764 5766 5760575057405760 5750 5740 5730 576057705780 OPRIS ES NGINEERING, LLC. CIVIL CONSULTANTS 19137.01JOB NO. DATE:04-15-22 502 MAIN STREET CARBONDALE, CO 81623 (970) 704-0311 FAX: (970)-704-0313 DESIGNED BY DRAWN BY CHECKED BY AD 01/28/22 AD 01/28/22 YN 04/15/22 DATE REVISION C-3.2 DRAWING NO. TITLE G:\2019\19137\CIVIL\CIVIL DWGS\PLOT\LIMITED IMPACT REVIEW\19137 C3.0 GRADING.DWG - Mar 31, 2022 - 1:34pmNORTHGRADING PLANROYAL MINI STORAGE AT WEST GLENWOODGARFIELD COUNTY, COLORADOLIMITED IMPACT REVIEW1 inch = ft. ( IN FEET ) GRAPHIC SCALE 020 20 40 20 8010 MEMBER UTILITIES FOR THE MARKING OF UNDERGROUND BEFORE YOU DIG, GRADE, OR EXCAVATE CALL 2-BUSINESS DAYS IN ADVANCE .QRZZKDW V 5 SHT C2.3 SHT C2.1 SHT C2.4 EXISTING WELL EXISTING 30% SLOPE LINE I I I I I I I / I I I I I I I I I I I \ I \ I I I I I 11 I I I I I I I I I I I \ I I I I I I I I ) I I I I I I \ I I I I I I I I I I \ I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I / / I I I \ I I I \ "" '---ti i ~ ~ I / \ \, / ~ \ \ ' \\ \t I \ I \ \1 \1\ i \\ \ /r ~ \ ,, I I \ I\ I\\ /\I 'I i ! i , I ' \ \I \ [11 \( I 1, I / Ii v ,,, ,, ·, /\ \I I 1\ \ \ \\ I\ '\ \ I\. \ \ ,"-'-I \ \ \ I i I I \ l"\1 \ I I \ \\ \\ I \ I I \ \ \I \ \'\ 11 I \'\ \ '\ r\ I \I\ \\ I I \ \ ,I \ I " i? ., t,. .~\" ' ,, ' / ,.--~ -',;,. .. ,, ' '\ ' .. t,. ,,. ... • \ \ \. ,, . . . .. --........ .. i,. -b> -"' I c..:.._ t> ,. ' . ·" .. ',. . . . --:: ~ "' ' . . --.., . \ \.• ~· . " . . . . " .. . ' . . . '\' • , •• ~· 0 b • "z' o "· b , , 'S, b o \ • .. 0 . ' ' ~ ' . "· ' . . ' --.., ~ . \ ,. . . . . • ' i' . . . " . • • ' '\ .. '\ ·6... .. ·1:,..A\, \ ·\·\.: '-._: ,. · >, ",l \"1, ... "'-. ,. ' \ . . "'· . , I \ •• • ·, ·--·1 ', -is:-. .. "" Ii .. / ., .. >< I:""' . ... _ .. I ........._ ---..__,., ti • ;c-• ~ •' • ,f / ' -/ ~ t> -.. ~ • / \I I \.. -,.-r ,, 1, \ ~ •• ·-• • I • ------• . • • '..,: /,I>~ • • ". . ~ \ . " \\ \ \\ "'\'---,,+---''.,:,.•.,....:•~1,-.,.i \ I \ \I • ' ' • • ''\ • ' ' • • .... ~.:>~-..Iii\ ' ., " ' • • ,,. • • ',, ' ••• ., • • • b l -" . ' '' .. ' ' ,. ' ., ,. . ' ' .. ' ' • • '-• .• . ' ."'-,\. • • ,•I • '.:. 4 ' '-' · ·"'-I 4 • ,\•'. . \. . . '\ . \ • • . • • I i ,'\ '. . . \ . .\· ' "• \ I I ' ' . ~ .. "-."' .. \ ~~ b • \ ,_,• •·1 ·, . "-. .. • :• .. ),, _,.,. i \ .. ~ ~ . .. ,,. . -' -~ ' • • I \ '\ .. 'l\ ' \ \ . ; ' I \ '1 \ \ ,\' ' \ \ ",,, ., b •1 b •'~ ... "-/· "-. ~· ', . ~,-. } • " • \ \ 1 •• • •' \ \ '\ I \ I " ' ,\ • . \ \ \ . : I I \ ', ' • • ' '\_,_. \ \ • \ • • \ \ I I ·• \' . • \ , • • \ I '. • '\ \ ,. • • ' ' • '\ \ • ' • \ \ I I I• \ \ '\ ""\ "' '\ \ • \ • • \ '< \ • \ • I'. • , "" ,, • " • \ i ,: " \\ \ i I . . \ \ '\ . '' . '\ '\ . . \ \ • • • • • , , ----• • " l--__ _,,__ __ _,,___--1' \• • " \ i I '\ ' ,.. ' \ '· I '\ ' •'\ ·' ,\. \ I " "' • "' • , \ ,\ \ \ \ \ i I ' " • . \ " . .• . . ' I I \I I I I ,1 I \ ~ 11 I \ I I \ I I I \ \ \ I I I \ I , I I\\\ \\I\ \l\l\l\\1\1\\ \ 11 '11\ 1111 \ \l\\111)\I\I\ \\\ 1111 1\1\ \ I I I I I I I I \ I \ I I I I I I I ( I I \ I \II 11\I \I\\ 111\1111\1111 1111 \\II \111 I 111\11\\\1111 1111 \\II \111 I 111\111\\11\ 1111 11\\ \\\ I 111\111\\\1\ \ 1111 \111 11 1111\1111\1\ 1111 \111 \\ I \ I \ \ I \ I \ \ \\ I \ I I I \ \\ , "' \ 11,1\\\\'\ \ \ I \ \ ' \\\'\'' \ \ \ ~' ", ' I \ '\ " ' ', ', \ \ \ \ ' '\ ' ' ,... 1llo..._ '\. ........_ -~ -..... ........_ \ ' I I I ! I I I I I I I j \ \ 1' I \ •• "'-., ·. \ ' . ~ • \ \ \ . \ \ 11 ' \. ,• \ \ •• \ I , ·, \ \ I,:· \·• \ I ', ·• \ '·. ~. I I I\ \ \ I \ \ '-. 'I \ I I I I I I I I \ I I I I t \ I I I \ \ I I I I I \ \ 1 I I I I I \ \ \ \ I I I I I 11 I I I \ I ) 1 I I I I I I I I I I I I I I I I I ~ I I I \ I I I I I I I : I \ I I I I I \ I 11 \1 I I I I \ II \ I I I \ ~ I I 1 I / I I 1\ \ / , I ,\J '\ \ ·,, / \ \\\ ';' ( ·-, r-\ I \ \ I I \ I ,I ,\ I I \ \l I \ \ I I ? \ \ ,.-I_ \ I I 1\ \ ,\ \ /' I \ I \ I \ ,, /\ \1 \ ,\ J I \ \ \' 11 '\ \ \ \ ' \ \ I \ \ \ \ ,\ '-. ,, I \ I I \ \ ,, \ \ ,, \ ' \ \ \ ,, ' '\ • \ , ', · ... \ \ I \ ·. \ J : I I '----• .. \ I ---.., I· ,0. ~-;,_ •• ' ' • " • I \ 11 \ 0-: , ' •, • \" \ \ \ •I, . I' I I I "" ', • \ . . \ \ I ' , .1 I I / \ I h-----~,-----:t, . _..__\ 1----'--...---+--:t \, • I' i----'----1--1 I , " ;,, • •. \ I \ ,\ I I / \1 , \ ~• \ \ \ \ • \ · • \ I I 11 \ \ I I \ ' , .. ' "\' 4 ,_.ti,. . \ ;, --.., . 4.. t,._ '·1 \ \ \ .. \ . . ,I \ \ ' \ i. . . • \ \ I \ I \' ' \ •, I I I I . \. . '\ I \ \ I I • \ \ . • · I I \ \ • \ "' I I ' " I I I ' , I \\ ~ \ \ \ I \ '--''\ 4 • 's----, \ \ • , . • I ; . \ I \ • \ •, \ \ • •\ I I\ I \ • I I \ " • • \ \ 11 ,· \ ( . • ,. 1· • • \ I I \" " \ I \ . " l-----------1· ' \ ', I \ • • I '\ I \ \ \ \I \ I • ) I "-r-.._ _..--..........J .. ~ ,, 1\ • I. \ .. · "-~1 ' • • • ' • • b ,. . \. . --.., " . ·1· I i \ .\ \ \ I I • I \ : • '\ • \ \ \ ' ,\ \ \ \ \ I \ \ ~\· \• \ \ \ \ \ \ \ \ ' . l \ \ \ . ·~ . 'I \ \ I I \ . ·\ . . \ \ \ . , \ \ ' \ • \ • \ \ I \ \ • I \ ••• \ \ ,1 \ \ .. \ I \ '\" • \ \ I I \ \ I /------b. .... '\ \ • '. \ I \ ,I ' . \ \ \ \\ '\ \ \ : . . \ I \ I \ I I " \ \ • I I \ •\ , \ I I\ '' ., \ \ . . \ ., . \ \ ----.. . \ \ \ '\ . \ \ . \ .. '\ • . •, \ \ . \ ' ·• I \ I • ' \ \ ~ \ \ ' \ I • I• • \ I I , I I I 1 / ,, •• I ; \ \ .,__,.-/ '\ '\• I \ ,.. • ' \· ' • • • \ '\ I I /\'•• . \ '• \ \ ,· I '--._,.-/ \. I ,\ • '\ \ \ \,. \ I I '• \ \ I •· '. " \ \ ~. \ \ 1 I \ I , • \ \ ·\ .\ \ . . \ \ \ . . ' ' . \ \ I . \ • \'. \ I I \ '! \ \ \ t t" • , I \ I' , • I \ 1 I •,'f \ I • I \ \ I •,.1· \• \ I I I I ~· \ ' 1, \ ,. -(___ I \ 1•. \ I ~ ,"\ I / ,___: \ . ~1---...:.---~--..µ..---c---.\-..:,___!,-1----i--_,,,.-~1 I/ \ \ I I I \ I \ \ I \ I \ \ ' ~ I \ I \ \ 11\ I \ II I \ \ I I '\ \ \ \ \ I \ \ I \ I I \ \ \ \ I I I \ '\ I \ \ \ \ '----\ \ I I I I ' / ~" '\ ' I I ( ( \ ~ I I \ \ '\ " -\ "\ ' \ \ \ I \ I '\ \ ---------, ""-------\ \ \ \ I \ \ I I I I I I I \ 1/<:'\ ~ ~ I I ( I I I \ I I I I \ \ I / \ I \ ' " ' \ \ \ : , I i1 I I I \ "' I \ \ \ I I I I I I I \ I I \ \ I I I I I I I I \ I I \ I I I \ \ \ \ I I I I I I I \ \ I I I I \ I \ \ I \ 11\ll\1 \\ ll\11 \ \ \ I I \ / I I I I \ I I I \ \ I \ I I I I I I I \ I \ \ I \ I I \ I I \ I \ I I \ \ / / / / I ., / / / d I I I \ \ I l \\ /"111\\ 'i"--\ I • . • --'--'--. ' . ' ' ' .· ,\, b. b. ):, /> I::, • •' . • • • ·' • ,· I . \. • . • \' • ·.• • • • I l. • , . , . . , · \ . . . I " • I •• . I· • ,. · , I 1>. I \' '\ • \ • • • \ • ' • 'I " • • • •• '\ •• I'' '\· • I I .,. .. ~-I> • \. , • •. I •. . • •\ . ·'' \.. • • • I • I . • \ 1 • • · 1 • • • • 1 • i • • I· \ • 1 • • • 1 • · 1· 1 • · \ , • . I. • • • . 'L , • • · • • I : I ". . I. • .. • • · " ' ' I I I I I / I / I ) I I I / I I I I \ 0 I» -CJ" ~er cil !!!. '<0 / I \ 11 I I \\ \ \ 11 \ 11 ' 1 \ I I \ I I I I I I ! 1, I \ /11: '(\It\ , ', I \ I \ I I I I \ \ ~ 111111 / 1 i ) 1 i/ I I / / I I ! I C I II I I I I ! I I II I I I // / I I I I I I ! I I I / I I \ ' I I I I I / I I I I I / ~ I It \1 11 \ I 1 I 11 I I 1 ; I 111 I I / \ I 11 I \ \ .1 \ '-I\,~, I I I \ ! \ I I I \ \ I I I \ \ I I I I I I '\ ,, \' I I I \ r:: I \ r-111/ 1 '\ 'I-I 1, /111 \ \ / I ' / I I , \ I I \ I I I ; : I / / I I I / I I I I I I I I I I I I ) I I I I I I ;I I I / I I I I I I/ / I i \ I I ~ / / I I I I I I I I I I; ' ) / / I I I I / ' / I I 11 I / 1 • I I I \ I I ' I I )\ I I I I I I I I I I II I I [ I \ !1 I I I I I I I I I I I I I 11 I I I / I 11 " 7 I I I I I / I I I I I I I / I I I I I I' // I I ! ! I I I \ \I \ I I / I I I I I 1111/11 \ \! I I I I I I / _ / I I I I I I I / / ' I I I I I I ! I I I I I I I I I I I I I I I I I I I I I I I I I I I I ! I I I I I I I / I Ii I I I I I I I I I I I I / I I' I 11 / I I I I I I ' I I I I I I I I I I I I I I I I I , I I ~ \ \ I / / ( ! I ( / ( I ~ \ I / / ,/ \, I I \ \ I I I \ ,, I I I \ ,\ ( J J ' / I I 1/ \ \ ~ I I I I / / \ I I I ii \ ,\ I \ ;-,, I I -I I I \ ' I I 11 ( I / \\ " t / ,' I I \ \ I I / I ., ·\ • \ ,\ • •• . , • • , \ . I · \ , . I • -------\ ~ .. .. 4 .. \ • t \ 4 b. ... \ 4 ) • .~ • • • I I I \ • •.,,,, ·~,· , " '\ .• . I'. · 1 •, \ • '1• ' I . . • • 'I, • '"'-• • '( '\ ' · \. • ,\ • ' -1 'f ' • I •, \s \" • • • • ' • • •· I,, • . • I • •, • • I •. • 1\ .. t, ~ I ,.. \. \ • I " 1• 1 · I .. -I ~-.. " -\ . • ,r: \ 4. .. i,,. / \ .. ; . \ -' \ / . ~ . . .. ·1 . .. 4 .. 4 ' ',/ . ' , \ . I t ,. . • • • • I I • /" ' ~ I \ • \, /'·. • • • / I,• ' . .--• .. \ .. • I • ./._ ". • / I I L • • / / I ----' • / -.___, 1 / / I 1.i, / I / / I I • / ; I /, ~ I I ' • . • • l " \·-•1. b \" : . ~ \ .. . .. • .. t,.· \ \ .. ~" .. \ ~ I \ \ /\I.• I \ I 1 \I . • I I \ \\\ ,. I \' ,\ ' ·, \ \ I \ \ 1· I I I \ \ I \ .~ . . .I \ \ \ \ \ I "\ \' . I \ I \ \ ! I I \ 1\ \ \ . ' ' . . ' \ I \ \ I I I .1. \; \ \ \ \ \ " 0\ • • I \ 1 1\ 1 \· '\• I \ \ \ \ I \ \ \ \ \ \ \ I I \ I I \ \ \ \ • • I I I I I ( I ~ I I • I I ·1 I I I I\ \ I , I , \ I ·1·· \ I I I\ \ I [ \ \ I \ I I I I I \ 11 ' ' ~, \., "-_,, -~ I \ \ \ I ) / ( I \ \ I I I \ \ -r \ I '-I ( \ I \ \ / f ., ' -• .. /•I . I . • .( .. I . ·, • • ' ' • • .. I _1 7 I • I ., • ' 1"." I>. • ' • • ,, I .. _/ ,· I • "-\ .. I • ·r. I • I ) ~ \ • . . \ ,; \ \ I I \ / b ". /I \ \ I \ \ / • /' ) I \ , ·• I \ \ \ I I / / . / I I• ' I I I I I ' I / I I I • I 11 ~. '1/ ,• I i . I' . J I I \ I \ ( / ,:,.✓ •• / ! ;: .,,/· / / 1_1--+: I I \ . I ..• / // I. I I : ' : : \ . I, I I I \ I • • / I I • I \ (•• I I • / I I I I \' \ \ I , . / ; • . I . • / I \ I I I · I I I , . · \ / 11 · • , I / I I I \.. I \ ," \· / •• / I I / I '•"' \ I I . • • / ' . /' I I I I I I • \c,. .. ~ I \ \,· •·\• \ I • .I · I I \ I •I I I I • I I \,' .• / I ' l . ' I I I I I I I, , ; I I I ; ; • I, . , •! I I I I I I \ \ I I I I I \ \ \ \ \ \ I I / I \ \ I \ \ 7 \ \ \ I \ \ I \ \ '\ ' \ \ I I I \ \ \ \ I '\ \ ! \ ~ I \ I \ 1, I \ \ \ \ \ \ \ \ I I I \ \ \ \ \ \ \ I \ \ I I \ \ \ \ \ \ \ \ I I I I I \ \ \ I I I I I I \ \ \ \ \ \ \ \ I I I I I \ I I \ I \ \ \ \ I I \ \ \ \ \ ' \ \ '\ \ \ \ \ \ \ \ \ \ \ I I I I I I I I I I \ ~1.......,..11 ' 1111 / I , i , ·1 / / ./' , ( \ I I I \ •, I ! I . 7·. / I 11 ~ · '!1----.,..----ll I I I / 1 , ; , ,./ I I I \ , I / ' \ /! • / I / ' , , I I \ I I :• I ; ( ' , I / I /, j ' \ I / I I 1\ II \ I· . I I I I I I \ \ I I I I I I \ \ I ) ' >, / I \ ++/ 11 / / I I \ \ I \ I / I ,\ \ I / I I \ \ I I I \ \ I I I I I \ \ \ \ I I ( I I \ \ ) \ I \\ I , I r '· • • •' • • , I I .•II I•• ; I \ I " "" I I I I I I 4 , I I I • • • I I , I ' I ;\ I I ' I I ' ' / ; !' ,' I ; / / I / / I / / I -/ / ) / / -~ / I I / I I I I I I I I I I I I I \ I ( \. I I I • ,;/' ./ / ;I' • • / / I / ~.. \ I I ! ✓ ' ) J I I I I I I/ .. I; I I \ • . . .'. I • / I • I•·• / / \1 .I/ I , • 1,,, /, 1 1 'b _r,. .._,_ __ _,___....1----'-'' : I / I ' • / / /\ I / I / / I / -/ / I I \ / I I I 1, \I I ( I ) I ) ✓------I .... ,. I o.-I " " . I · ' /' ' ,,. · ·•· ;;, · • ,,, • 7 , . I .. _ ... I . • / .. -... -I "·/ I • . ,,_,"' • . • ,,,-,, • , / ; / ; '! ' /·' •• / • / '' / 1 . .I'· •• I• ,'/ I' •"i ;• ,,------• .... ,,. ; \/ • 1•" .. _/ .. t,. ,. b._l 4 bf ·";··· ·7. --;'. /' :~,>· . ,· /. // // ' \ • / • • J ' • '/ . . !' I' I • , • /;: . ' • / / / \ / 4 / 4 / 4 j .• 0 I I . A I b. ,;{i,. t,. / .... . " 4 / / / ; • I ' b ' •; / • / . . . ' ' . . . . . . // ( ' . / / "·. I •• I • •. • • I .• • . . ' / I • 7 , . t . /· ... 1 • (. 1 1 , ·. , •' I,,· • , --✓ , , / // \ • I l • ·1 • I • I b j' • • .. ' f " I • ( • • ' / / / \ I • ; • • • • -I ... • • I .. .✓. • • ' I • ! ( • I • • • ·I • / I \ ,• ' •I I • • • I • I • , I ' '. I . ' . ! I. I / , i.. • ·1 • • r . i • . i.. • i • , •. ,., • .1 / ,,,, ~" ........ ,· ,•.•· ;• /, ) .. -.... ; .. I t,. t,. ·I ... r / / ' I J ----r--f----+-----f--~--✓__::_.-__ / / I / / // / /, -+--If--_; -,--, ,,. I )__ \ I J I I I )----r----r--1---!,------;L-_L __ ,::-,.._ I !/ ( , , I / : \ \ ( 111 i ( / I v1 I )\ I ~ .. \ / I / ,,j j \ I I I / ,/ / \ \ V / / I / I I I I / / / / ,.-I / / / / / / / / I / / -/ / / -I I I I I I / I I / I / '; / / ,.-/ I I / / / / / / / / / I / I / ,.-r ~ / I ( / \ / / / / --~/ / / / / I ,,.--~ ( ) / I I \;'I// J I / I .,-----( ' ' / v ( \ :::.. \ / / I \ -:~ I e---I I I ~--~ I ~ I ( ) I I I \ \ I / I I I I ' \ / ( f / ( / / \ I I ( I I I I / / I I I I I I _-r_ -' I \ I I :... I / -1 I I I I / \ / I I I I -\~ I I \ I ( \ \ \ T I I I I '\ I I I I ( I I I \ \ " \ '--" \ I I '--'---~ I \' \ ,, ,, 0 g :E -----C. a:, ---- >>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>> >>xxxxxxxxxx xxxxxxx57 8 0 5760 5770 5790 5800 5784 5776 5794 5760 5770 5750 5790 5792 57 9 0 5798 R20' PROPERTY LINE PROPERTY LINE PROPERTY LINE C1 C2 C3 C4-2.1:1-2.0:1-2.0:1-2.0:1-2.0:1-2.6:10.9% 1.1% 1.0% 1.1% 1.0% 1.0%1.0%1.6% 1.7%1.1%FFE:5765.83' FFE:5766.46' FFE:5773.45' FFE:5773.95' FFE:5774.45' FFE:5774.95' FFE:5774.45' FFE:5773.95' FFE:5773.45' FFE:5772.95' FFE:5770.16' FFE:5769.67' FFE:5769.16'FFE:5768.66' FFE:5768.16' FFE:5768.26' FFE:5768.76' FFE:5769.26' FFE:5769.76' FFE:5770.26' FFE:5767.76' FFE:5768.26' FFE:5768.76' FFE:5769.26' FFE:5769.76' FFE:5770.26' C5 -2.8:1-2.8:1-2.6:1-2.3:16.5%57 8 0 57745770 5760 5760577057681.0% RIM:5771.26' RIM:5773.06' RIM:5774.33' RIM:5774.26' RIM:5770.73' RIM:5770.34' RIM:5769.15' RIM:5768.35' RIM:5767.80' RIM:5768.55' RIM:5769.44' RIM:5770.37' FFE:5770.76' FFE:5770.76' FFE:5770.66' FFE:5771.16' 2.9% 5800 5790 5780 5770 57 7 0 5780 5790 5800 5770 5780 5790 5800 5770576857705770 5766 5762 5762 5766 577457 7 8 57765776 5770 5766 5762 5764 5770 5766 5762 5758 5756 5754 5752 5750 5748 5746 RIM:5770.81' 1.0% 2.1% 1.0% 2.9%0.0%1.0%1.0%1.0%0.9%1.7%1.0%1.0%1.0% 1.0%1.0%2.1%1.0%1.0% 1.0% 6.6% 5.3%1.0%2.1% 1.0%1.0%1.0%HWY 6 I-70 I-70 EMPTY FIBER CONDUITS oe OPRIS ES NGINEERING, LLC. CIVIL CONSULTANTS 19137.01JOB NO. DATE:04-15-22 502 MAIN STREET CARBONDALE, CO 81623 (970) 704-0311 FAX: (970)-704-0313 DESIGNED BY DRAWN BY CHECKED BY AD 01/28/22 AD 01/28/22 YN 04/15/22 DATE REVISION C-3.3 DRAWING NO. TITLE G:\2019\19137\CIVIL\CIVIL DWGS\PLOT\LIMITED IMPACT REVIEW\19137 C3.0 GRADING.DWG - Mar 31, 2022 - 1:32pmNORTHGRADING & EROSION CONTROL PLANROYAL MINI STORAGE AT WEST GLENWOODGARFIELD COUNTY, COLORADOLIMITED IMPACT REVIEW1 inch = ft. ( IN FEET ) GRAPHIC SCALE 020 20 40 20 8010 MEMBER UTILITIES FOR THE MARKING OF UNDERGROUND BEFORE YOU DIG, GRADE, OR EXCAVATE CALL 2-BUSINESS DAYS IN ADVANCE .QRZZKDW V 5 SHT C2.1 SHT C2.4 SHT C2.2 DAYLIGHT: 5745.3' ± INV: 5776.76' 12" ADS N-12 SECURITY GATE INV IN: 5761.37'170LF OF 60" ADS N-12 SMOOTHED WALL PIPE @ 9.29%d . .,. 4 . ---- d • • • d , ~-'--""'-... • • ---------E ,. \ \ I 7' I ,,..,..------- ------ • • \ \ \ - - -----~ . • --- • • • --------------- -- \_ / / ./ / I • • /4--"- --------- / / -- • I ~ ----------- ----- / / I . . I / f • ~ :----- • I I I --- I / I I / \ \ I I \ / ,-/ \ \ \ \ \ \ \ . \ I \ 11 \ \ \ / I \~ • I / / \ I I \ \ \ / / \ \ I \ --------✓ ,-/ ~ ------,,.,--- ---- / / \ I I \ \ \ I .J I \ \ \ \_ • / / / I I \ \ -- ) I / \ I ~ r '---- '---- - ----- / I / / _-;, I -------f--~ I I ~ I I / I I I I I / I I • - I d I • • \ \ ' 0 rr,r, / / " / ---·.-· ' ------/ - - -/ / ., ✓:;; • I ' / • '7. L-----...;'....----------J------.-...: ... --------.1-----.. -------------.l-----,,..11----...... ---:..-.,,.---J.--..:>---J /4. ., • /'-,,~. d •• ~ .:. •• ,~ ---• • • ·, / ... ,F··· ~/d,.,,.,,-~ "/ I • ' I ' ' • ' •/ " ' ' / • 0 ' • •, " ' -• o • --•' ' ' --•-• •·. d / • ja / ,/ -/ . -~ '. ' -" . ' ' ' .. / ' /·'. ,__;a. .. -,->•c.--• __________ .;...;--/"';_....a;:;...;,-,c;"--..:----..,;-c..-'""'""------,._ ___ ..:-------------..:"'-~---·•---.-'---/ -_.-ca-. c'--c ~ ./ . ' -. -_. a .• -" -' . / .r . -=-.-----""-"'" -__ .__._...;_-11-- 1 ,, ' • -' ' ' ' ' •-' • / • / ' I "'· . '-._ • ' -· ;" ,. .:1/ "'" / ,:37 ' ' • ' < • -•,-' ', -~ / ' . • . "" " '-~---' .-,· - / --.,, --/ / i • • • I • • d / / • ) / / ------------ C below all before you·d. 19. xxxx5780575 0 57 3 057605770 5790 EXISTING LEECH FIELD EXISTING WELL EXISTING PROPANE TANK PROPERT Y L I N E OUTDOOR STORAGE-2.2:1-2.0:1-2.1:1-2.3:1-1.9:1-2.6:1 5762 5764 5780 5770 577057805750 5760 5 7 6 0 5 7 5 0 5784 5782 -2.3:1-1.9:1-2.0:11.0%2.0%2.0% 2.6% 1 0 . 2 % 10.4 %5.0%0.7%2.0%3.2% 1.5% 1.0% TOW:5778.93' TOW:5787.47' TOW:5789.46' TOW:5799.48' BOW:5794.48' BOW:5783.98' BOW:5780.77' BOW:5778.47' FFE:5782.50' HWY 6 I-70 I-70 EMPTY FIBER CONDUITS WALL PROFILE 5770 5780 5790 5800 5770 5780 5790 5800 0+00 0+255782.05787.480+505784.05789.480+755792.05799.480+81 5794.0 5799.48 OPRIS ES NGINEERING, LLC. CIVIL CONSULTANTS 19137.01JOB NO. DATE:04-15-22 502 MAIN STREET CARBONDALE, CO 81623 (970) 704-0311 FAX: (970)-704-0313 DESIGNED BY DRAWN BY CHECKED BY AD 01/28/22 AD 01/28/22 YN 04/15/22 DATE REVISION C-3.4 DRAWING NO. TITLE G:\2019\19137\CIVIL\CIVIL DWGS\PLOT\LIMITED IMPACT REVIEW\19137 C3.0 GRADING.DWG - Mar 31, 2022 - 1:33pmNORTHGRADING AND EROSION CONTROL PLANROYAL MINI STORAGE AT WEST GLENWOODGARFIELD COUNTY, COLORADOLIMITED IMPACT REVIEW1 inch = ft. ( IN FEET ) GRAPHIC SCALE 020 20 40 20 8010 MEMBER UTILITIES FOR THE MARKING OF UNDERGROUND BEFORE YOU DIG, GRADE, OR EXCAVATE CALL 2-BUSINESS DAYS IN ADVANCE .QRZZKDW V 5 SHT C2.3 SHT C2.1 SHT C2.2 30% SLOPE LINE WALL PROFILE SCALE VERTICAL: 1" = 20' HORIZONTAL: 1" = 20' PROPOSED GABION WALL FOR ROCKFALL MITIGATION EXISTING HOME TOP OF WALLBOTTOM OF WALL EXISTING CONDITIONS TOP OF WALL BOTTOM OF WALL / I /1 I / / / / / I I 11 I I I I / I I I / / / / / / / / / / I / I / / / \ / I / / I I \ \ \ I / / I I I I I I I ) / / / I / / / / / / / / / I / / / / / / / / I / / I I I / ( / / / / / / I I I / I I I / ; ; I I / / I I I I / / / // // / / / / / / / / / / I / I I , / i I i i / / / / I / I I / I I I I I I I I I / I I / / / / / I / / I / / / I I I I / / / I / I I / I I I ------/ ~ ~ \ I / \ \ \ \ \ / I / _-/ / _,,---/ -------------/ / 0 0 0 0 Q Q Q Q 0 0 0 Q Q Q Q Q / / 0 0 0 0 Q Q Q Q \ 0 0 ~ 0 c:: Q c:: Q / / / / -- / / -/ --/ -/ / / / / / / / -/ / / / / / / / / / / / / -----" -\ \ \ \ \ \ ) / / / / / / / / / ---/ / \ I I I I I \ I I I \ I I I I I I I I I I I I I I I I ,,. I I I I I I I ; I I / l I \ I \ \ II \ // II I I / I / / / / / / / / / -/ I I I I / '- " "" \ \ ( 0 rur, , _-/ \ \ ---- below. Call before you dig. ue ue ueueu e ue ue ue ue ue ue ue ue ueueueueueoe oe oe oe oe oe oe oe oeoe8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL 8''WL 8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL2''WL 2''WL 2''WL 2''WL8''WL 8''WL 8''WL8''WLUEUExxxxxxxxUEUEUEUEA1 A2 A3 A4 A5 A6 A7 OUTDOOR STORAGE EXISTING LEECH FIELD EXISTING WELL SERVING EXISTING HOME PROPERT Y L I N E PROPERTY LINE PROPERTY LINE PROPERTY LINE PROPERTY LINE PROPERTY LINEC1 C2 C3 C4 OUTDOOR STORAGE EMPLOYEE HOUSING OFFICE EXISTING HOME WESTBOUND INTERSTATE 70 HIGHWAY 6&24 EXISTING DIRT ROAD C5 B1 B2 B3 B4 B5 B6 B7 B8C2.1EXISTING OVERHEAD ELECTRIC PROPOSED 8" WATERMAIN FROM TANK EXISTING UNDERGROUND ELECTRIC NEW LOCATION OF UNDERGROUND ELECTRIC PROPOSED FIRE HYDRANT EXISTING DRY HYDRANT EXISTING ELECTRICAL TRANSFORMER EXISTING PROPANE TANK PROPOSED GABION WALL PROPOSED OWTS EXISTING DRIVEWAY REDUCER TO 2" WATER LINE OPRIS ES NGINEERING, LLC. CIVIL CONSULTANTS 19137.01JOB NO. DATE: 502 MAIN STREET CARBONDALE, CO 81623 (970) 704-0311 FAX: (970)-704-0313 DESIGNED BY DRAWN BY CHECKED BY AD AD YN DATE REVISION C-4.0 DRAWING NO. TITLE G:\2019\19137\CIVIL\CIVIL DWGS\PLOT\LIMITED IMPACT REVIEW\19137 C4.0 UTILITY PLAN.DWG - Mar 31, 2022 - 1:38pmNORTHUTILITY PLANROYAL MINI STORAGE AT WEST GLENWOODGARFIELD COUNTY, COLORADOLIMITED IMPACT REVIEW1 inch = ft. ( IN FEET ) GRAPHIC SCALE 075 75 150 75 30037.5 MEMBER UTILITIES FOR THE MARKING OF UNDERGROUND BEFORE YOU DIG, GRADE, OR EXCAVATE CALL 2-BUSINESS DAYS IN ADVANCE .QRZZKDW V 5 04-15-22 02/11/22 02/11/22 04/15/22 PROPOSED WATER TANK 180,000 GALLONS EXISTING WELL TO FILL TANK EXISTING WELL TO SERVE EMPLOYEE HOUSING UNIT WATER SERVICE TO EMPLOYEE HOUSING UNIT PROPOSED FIRE HYDRANT PROPOSED FIRE HYDRANT PROPOSED FIRE HYDRANT I \ \ \ \ '\ \ \ j ~:...-:--------=::.:----------------==--1-------==------------==---L------'~ _____________ _::.:c=======~======1 I 1 \ \ • • C below all before you· dig. 4''SS4''SS4''SS4''SS4''SS4''SSsasvcsasvcsasvcsasvcsasvcsa svc4''SSue ue ue ue ue ue ue ue ueueue ueueueue ue ueueueueueueueueueueoe oe xx8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WLUEUEUEUEUEUEUEUEUEUEUE xxxxxxxxxxxx xUEUEUEUEUEUEUEUEUEUEUEUEUEUEUEINSTALL 1000 GALLON 2-COMPARTMENT CONCRETE SEPTIC TANK (USE VALLEY PRECAST ITEM # IM 1000-2CP) W/ SEALED RISERS AND LIDS INSTALLED AT THE FINISHED GRADE SURFACE. INSTALL INLET SANITARY TEE AND OUTLET EFFLUENT FILTER SANITARY TEE. DEPTH TO TOP OF TANK FROM PROPOSED GRADE IS APPROXIMATELY 18". EXCAVATION DEPTH 1' MIN.-4' MAX. BELOW SURFACE GRADE MINIMUM. 12" COVER OVER TOP OF CHAMBERS FILL & GRADE FIELD AREA APPROXIMATELY 3"-6" ABOVE EXISTING SURFACE GRADES 4" PVC DISTRIBUTION PIPES (TYP.) 4" PVC EFFLUENT PIPE @ MIN. 1 %, USE SCHD-40 0R SDR-35 ABSORPTION/TREATMENT FIELD USE 44 QUICK-4 CHAMBERS IN 4 TRENCHES WITH 11 CHAMBERS PER ROW FOR A TOTAL ABSORPTION AREA OF 528 S.F. THE SYSTEM SHALL BE PLUMBED FOR EQUAL GRAVITY DISTRIBUTION. THE CHAMBERS SHALL BE INSTALLED ON LEVEL GRADE IN EACH TRENCH. THE BOTTOM OF EACH TRENCH TO BE EXCAVATED TO A MAXIMUM AVERAGE DEPTH OF 36 INCHES BELOW THE EXISTING SURFACE GRADES, WITHIN THE UPPER HORIZON OF THE NATIVE SANDY SILT LOAM SOILS & BACKFILLED WITH A MINIMUM 12-INCHES OF COVER OVER THE CHAMBERS. THE FINISH GRADE ACROSS THE FIELD SHALL BE SLIGHTLY MOUNDED A MINIMUM 6-INCHES ABOVE EXISTING ADJACENT GRADES. CONCRETE DISTRIBUTION BOX WITH BAFFLE INSTALLED LEVEL ON COMPACTED BASE INSTALL RISERS AND LID TO SURFACE 4" PVC SEWER PIPE @ 2%, USE SCHD-40 0R SDR-26 INSTALL 4" RISER PIPE INSPECTION PORT EXTEND RISER W/ PUSH ON CAP MIN. 4" BELOW FINISH GRADE & COVER WITH 6" DIA. VALVE BOX SET WITH LID 1" ABOVE FINSH GRADE (TYP. EACH TRENCH CHAMBER END CAP) INSTALL CHAMBER END CAP ON ALL END CHAMBERS PPROPOSED SOIL PROFILE PIT 4" TWO-WAY CLEANOUT UNDERGROUND ELECTRICAL LINE TO BE MOVED TO ALLOW FOR ABSORPTION FIELD PLACEMENT A1 A2 A3 EMPLOYEE HOUSING UNIT OFFICE BUILDING CARPORT C4 C5 DEBRIS BASIN 2 OPRIS ES NGINEERING, LLC. CIVIL CONSULTANTS 19137.01JOB NO. DATE:04-15-22 502 MAIN STREET CARBONDALE, CO 81623 (970) 704-0311 FAX: (970)-704-0313 DESIGNED BY DRAWN BY CHECKED BY PR 01/17/22 PR YN 04/15/22 DATE REVISION C-4.1 DRAWING NO. TITLE G:\2019\19137\CIVIL\CIVIL DWGS\PLOT\LIMITED IMPACT REVIEW\19137 OWTS DESIGN.DWG - Mar 31, 2022 - 1:39pmNORTHOWTS PLAN 1 inch = ft. ( IN FEET ) GRAPHIC SCALE 020 20 40 20 8010 MEMBER UTILITIES FOR THE MARKING OF UNDERGROUND BEFORE YOU DIG, GRADE, OR EXCAVATE CALL 2-BUSINESS DAYS IN ADVANCE .QRZZKDW V 5 01/17/22 ROYAL MINI STORAGE AT WEST GLENWOODGARFIELD COUNTY, COLORADOLIMITED IMPACT REVIEW==.• ... =.==.=•-~===··.===.S-""'•=""====~-===·.====-~==J..----------------.-.1---.----~.---------1.---------1-..,.---.,..---J------"""'·,...---.. ---,,----.-1 , , ' , , , ' , • • • . • , • • •• • • , • • ~ . . • • • • , • • • • d • • • • A ' , • • cl • ~ d ' • • , • • , • • d .,, • • • • • • • , • / ... • • , • . • •-'-""I"" • .., ,4 £1 __. • 4 .. ----- • A • • , \ • •· , • • ., • ' • , • • • • A Li;, • .....,____ •• ~ • • • • •• • • • , . • • • • • • .. , . , I \ I \ • • ------------ • . . , ff. • • • d • ,. • .. d . • • d • • . ., • • , . • • • \ • • • , • d .. • • , . • ., '° • • • ,• .• • . • • ,· • •· • . . • • • • • • • • ,j • d •• • • A • ,, • • • • . . • . •• : , • • d • , • • • • • . • . .., • . • , • • ' . , • • • . • , .. • . • <' , . ,. • • • • ~ , • • -, • d ~., • ~ ___._ • , • . . -, • ..... . • . . , • • • • • • • • .-• A , • .-.. , 1 • I • • • • --------------------- -------■----------------------1---------------------------------A". 4' C below all before you· d' 19. Pre-Construction Notification, Nationwide Permit 39 April 2022 Royal Mini Storage West Glenwood (SME# 190050) SME Environmental, Inc. ATTACHMENT 3 USFWS IPaC Consultation and Trust Resources Determinations Endangered Species Act Compliance Documentation The following information is provided in accordance with General Condition 18 (Endangered Species). On February 1, 2022, the U.S. Fish and Wildlife Service's (USFWS) on-line Information, Planning, and Conservation (IPaC) decision support system was utilized to generate a location-specific list of trust resources with potential to be impacted by the proposed project (USFWS project code: 2022-0002038). Trust resources include species and critical habitat under the jurisdiction of the Act of 1973, Section 7(c), as amended (16 U.S.C. 1531 et seq.). Table 1 below identifies the site-specific trust resources. A “may affect” determination is warranted for four fish species due to impacts associated with water depletions. A “no effect” determination is warranted for the remaining species due to a lack of species or suitable habitat in or near the project area. No designated critical habitat is within or adjacent to the project area. Table 1. Trust Resources Identified by the USFWS for the Project Site. Mammals Canada lynx (Lynx canadensis) (F) Habitat: Moist coniferous forests which experience cold, snowy winters and provide a prey base of snowshoe hare (Lepus americanus). In the Southern Rockies, primary habitat is found in the subalpine and upper montane forests between 8,000 -12,000 feet (ft) (2,248 – 3,657 meters (m)). Preferred secondary habitat attributes include uneven-aged stands, boulder outcrops, and downed logs (USFWS ECOS 2018). Preferred habitat for crossing highways includes areas on north-facing slopes, within drainages, and consisting of dense canopy cover, primarily coniferous (Baigas et al. 2017). Potential to occur in the project area: NONE No suitable lynx habitat occurs in the immediate project area or vicinity. Project area habitats include dry meadow and woodland and surrounding habitats include open/scattered coniferous woodland on southerly slopes, montane shrubland on northerly slopes, and scattered riparian shrublands along the Colorado River. No coniferous forests occur within one (1) mile of the project area. Available data does not indicate that the project area may be utilized by lynx: x Lynx habitat in the region was modeled by the U.S. Forest Service (USFS) using habitat criteria in the Lynx Conservation Assessment and Strategy (LCAS) and through coordination with the USFWS. The nearest modelled suitable habitat occurs 2.2 miles north of the project area. The project is not within or near a USFS lynx analysis unit or lynx linkage area. x The nearest CPW-mapped (2020) predictive habitat use area is located 1.7 miles north of the project area. x Data from tracked lynx summarized by Theobold and Shenk (2011) shows the nearest population-level lynx utilization area is located 24 miles to the southwest. x Based on existing vegetation and topography, Baigas et al. (2017) mapped the probability for lynx highway crossing use at a landscape scale along the main highways within Colorado. The section of Interstate 70 just south of the project area was not mapped as having potential for lynx crossing use. Determination: NO EFFECT Lynx are unlikely to occur in the project area or vicinity due to a lack of suitable habitat or probable use. Birds Mexican Spotted Owl (Strix occidentalis lucida) (T) Habitat: Typical selected habitat is old-growth or mature mixed conifer, pine-oak, and riparian forests displaying the structural components of uneven aged stands, high canopy closure, multi-storied levels, and high tree density; downed trees and prominent snags also present. May also utilize canyon habitat with rocky, vertical cliffs with stringers of forested vegetation. Utilized mixed-conifer forests are dominated by Douglas-fir (Pseudotsuga menziesii) and/or white fir (Abies concolor), with co-dominant species including southwestern white pine (Pinus strobiformis), limber pine (P. flexilis), and ponderosa pine (P. ponderosa) (USFWS 2012). Potential to occur in the project area: NONE No suitable coniferous forest or canyon habitat occurs in the project area or vicinity to support Mexican Spotted Owl (MSO). Steep slopes in the project vicinity support scattered coniferous woodland cover on southerly slopes and dense montane shrubland on northerly slopes. No vertical- walled canyon habitat is present and the nearest forest habitat is over one (1) mile away. Determination: NO EFFECT MSO are unlikely to occur in the project area or vicinity due to a lack of suitable habitat. Western Yellow-billed Cuckoo (Coccyzus americanus) (T) Habitat: Large tracts of deciduous broad-leaved woodland with dense, scrubby undergrowth along watercourses. In willow-cottonwood habitats, marginal conditions have been described as an intact stand of a minimum of 50 acres (20 hectares [ha]) and a minimum width of 330 - 660 ft (100-200 m); suitable habitat as a stand of 100-200 acres (40-80 ha) and a width of 660 – 1,960 ft (200-600 m), and optimal habitat as a stand of more than 200 acres (80 ha) and a width greater than 1,960 ft (600 m). Habitat less than 38 acres in extent (15 ha) and less than 330 ft (100 m) wide is considered unsuitable for the western yellow-billed cuckoo (YBCU) (Laymon and Halterman 1989, Johnson et al. 2007). Potential to occur in the project area: NONE No significant deciduous trees cover occurs in or near the project area. The dominant tree along the Colorado River in the project vicinity is ponderosa pine (Pinus ponderosa). No suitable habitat for the YBCU occurs in or near the project area. Determination: NO EFFECT YBCU are unlikely to occur in the project area or vicinity due to a lack of suitable habitat. Fish Bonytail (Gila elegans) (E) Colorado Pikeminnow (Ptychocheilus lucius) (E) Humpback chub (Gila cypha) (E) Razorback sucker (Xyrauchen texanus) (E) Habitat: Large rivers with strong currents, deep pools, and quiet backwaters in the Upper Colorado River Basin (USFWS ECOS 2016). Potential to occur in the project area: NONE No suitable habitat occurs in the immediate project area. The Colorado River, as near as 240 feet to the south, may have suitable stream morphology, but the temperature regime in this higher elevation reach of the river is unsuitable for the endangered fishes (Osmundson 2001). Designated critical habitat for the Colorado pikeminnow and razorback sucker occurs downstream at Rifle, 8 miles west of the project area; critical habitat for the other two species is 76 miles to the west. Determination: MAY AFFECT, LIKELY TO ADVERSELY AFFECT The proposed project includes the use of three existing permitted groundwater wells to supply water for an existing residence, a proposed new residence, fire suppression, and landscape irrigation. While there is no suitable habitat in the analysis area for federally listed fish species, water depletions associated with the existing/proposed water developments have/would have adverse downstream effects to endangered fishes and their designated critical habitats. The proposed water system would indirectly draw water from the Colorado River via groundwater tributary to the river in a reach upstream of occupied habitat for the species, including designated critical habitat. The proposed depletions would contribute to an incremental reduction in downstream flows within the Upper Colorado River above the confluence with the Gunnison River. Depletion impacts to flows within the basin cumulatively alter stream hydrographs, reduce habitat, concentrate contaminants, and increase water temperatures. This can have negative effects on all life stages of the species and negatively impact elements of designated critical habitat. Estimated depletions for the proposed action are summarized below in Table 1.1 and are based on information provided by the project engineer (Sopris Engineering, LLC). Depletions will be associated with domestic use at two single-family residences, irrigation of <1 acre of landscaping around structures, irrigation of 4 acres of tree screening, and filling a 185,000-gallon (0.68 acre-foot) onsite storage tank for fire suppression. For the purposes of USFWS consultation, historic depletions refer to those existing and ongoing depletions associated with domestic water use at the existing onsite residence, and new depletions are those depletions beyond the historic depletions. Historic average annual depletions are estimated to be 0.03 acre-feet. New depletions include a one-time depletion to fill the onsite storage tank (0.68 acre-feet) as well as a long-term average annual depletion of 9.41 acre-feet for new domestic and irrigation uses. Table 1.1: Estimated Water Depletions associated with Royal Mini Storage West Glenwood. Use Diversion (ac-ft/yr) Depletion Factor Depletion (ac-ft/yr) Historic Depletions Household/Domestic* 0.28 10% 0.03 New Depletions Household/Domestic* 0.28 10% 0.03 Irrigation** 12.50 75% 9.38 Long-term Storage 0.68 100% 0.68 Total Depletions Year One 10.12 All Subsequent Years 9.44 * Based on an average single-family residential in-home usage of 250 gallons per day. ** Based on an annual application rate of 2.5 acre-feet/acre (equivalent to 60 inches). Plants Ute Ladies'-tresses (Spiranthes diluvialis) (T) Habitat: Early- to mid-seral, moist to wet conditions, where competition for light, space, water, and other resources is normally kept low by periodic or recent disturbance events. Major occupied habitat types include (1) alluvial banks, point bars, floodplains, or ox-bows associated with perennial streams, with a high water table and short, perennial graminoid- and forb-dominated vegetation maintained by grazing, periodic flooding, or mowing; (2) river floodplain habitats which experience regular spring flooding and/or frequent large scale floods but maintain relatively stable, moist to wet soil in summer, within moist meadow, riparian woodland, or riparian shrubland communities; (3) shores of lakes and reservoirs, in mesic meadow-type vegetation maintained by lake level fluctuations or seasonal flooding of gravel bars; (4) groundwater-fed springs, sometimes in desert settings, or sub-irrigated meadows where edaphic characteristics (e.g. high water table and calcic soil), fire, and/or grazing are sufficient to prevent invasion of later seral vegetation; and (5) human- influenced habitats, including perennial stream, river, lakeshore, and spring sites directly associated with human-developed dams, levees, reservoirs, irrigation ditches, reclaimed gravel quarries, roadside barrow pits, and irrigated meadows. Potential to occur in the project area: NONE No wetlands or mesic meadows occur in the project area or vicinity. The project site and surroundings are located on rocky, south facing slopes. Meadows are not irrigated and periodic run-on from storm events is not sufficiently frequent or of a magnitude to support suitable hydrology. In addition, there is no evidence of a disturbance regime in the survey area that could establish and maintain suitable Spiranthes diluvialis (SPDI) habitat. No suitable habitat is present to support SPDI. Determination: NO EFFECT SPDI is unlikely to occur in the project area or vicinity due to a lack of suitable habitat. E = federally listed as Endangered, T = federally listed as Threatened. February 01, 2022 United States Department of the Interior FISH AND WILDLIFE SERVICE Western Colorado Ecological Services Field Office 445 West Gunnison Avenue, Suite 240 Grand Junction, CO 81501-5711 Phone: (970) 628-7180 Fax: (970) 245-6933 http://GrandJunctionES@fws.gov http://www.fws.gov/mountain-prairie/es/Colorado/ In Reply Refer To: Project Code: 2022-0002038 Project Name: Glenwood RV Subject:List of threatened and endangered species that may occur in your proposed project location or may be affected by your proposed project To Whom It May Concern: The enclosed species list identifies threatened, endangered, proposed and candidate species, as well as proposed and final designated critical habitat, that may occur within the boundary of your proposed project and/or may be affected by your proposed project. The species list fulfills the requirements of the U.S. Fish and Wildlife Service (Service) under section 7(c) of the Endangered Species Act (Act) of 1973, as amended (16 U.S.C. 1531 et seq.). New information based on updated surveys, changes in the abundance and distribution of species, changed habitat conditions, or other factors could change this list. Please feel free to contact us if you need more current information or assistance regarding the potential impacts to federally proposed, listed, and candidate species and federally designated and proposed critical habitat. Please note that under 50 CFR 402.12(e) of the regulations implementing section 7 of the Act, the accuracy of this species list should be verified after 90 days. This verification can be completed formally or informally as desired. The Service recommends that verification be completed by visiting the ECOS-IPaC website at regular intervals during project planning and implementation for updates to species lists and information. An updated list may be requested through the ECOS-IPaC system by completing the same process used to receive the enclosed list. The purpose of the Act is to provide a means whereby threatened and endangered species and the ecosystems upon which they depend may be conserved. Under sections 7(a)(1) and 7(a)(2) of the Act and its implementing regulations (50 CFR 402 et seq.), Federal agencies are required to utilize their authorities to carry out programs for the conservation of threatened and endangered species and to determine whether projects may affect threatened and endangered species and/or designated critical habitat. 02/01/2022 2 Ƒ Ƒ Ƒ Ƒ A Biological Assessment is required for construction projects (or other undertakings having similar physical impacts) that are major Federal actions significantly affecting the quality of the human environment as defined in the National Environmental Policy Act (42 U.S.C. 4332(2) (c)). For projects other than major construction activities, the Service suggests that a biological evaluation similar to a Biological Assessment be prepared to determine whether the project may affect listed or proposed species and/or designated or proposed critical habitat. Recommended contents of a Biological Assessment are described at 50 CFR 402.12. If a Federal agency determines, based on the Biological Assessment or biological evaluation, that listed species and/or designated critical habitat may be affected by the proposed project, the agency is required to consult with the Service pursuant to 50 CFR 402. In addition, the Service recommends that candidate species, proposed species and proposed critical habitat be addressed within the consultation. More information on the regulations and procedures for section 7 consultation, including the role of permit or license applicants, can be found in the "Endangered Species Consultation Handbook" at: http://www.fws.gov/endangered/esa-library/pdf/TOC-GLOS.PDF Please be aware that bald and golden eagles are protected under the Bald and Golden Eagle Protection Act (16 U.S.C. 668 et seq.), and projects affecting these species may require GHYHORSPHQWRIDQHDJOHFRQVHUYDWLRQSODQ (http://www.fws.gov/windenergy/eagle_guidanc Attachment(s): Official Species List USFWS National Wildlife Refuges and Fish Hatcheries Migratory Birds Wetlands 02/01/2022 1 Official Species List This list is provided pursuant to Section 7 of the Endangered Species Act, and fulfills the requirement for Federal agencies to "request of the Secretary of the Interior information whether any species which is listed or proposed to be listed may be present in the area of a proposed action". This species list is provided by: Western Colorado Ecological Services Field Office 445 West Gunnison Avenue, Suite 240 Grand Junction, CO 81501-5711 (970) 628-7180 02/01/2022 2 Project Summary Project Code:2022-0002038 Event Code:None Project Name:Glenwood RV Project Type:New Construction Project Description:RV park in Glenwood Project Location: Approximate location of the project can be viewed in Google Maps: https:// www.google.com/maps/@39.5623525,-107.38265201684096,14z Counties:Garfield County, Colorado 02/01/2022 3 1. Endangered Species Act Species There is a total of 9 threatened, endangered, or candidate species on this species list. Species on this list should be considered in an effects analysis for your project and could include species that exist in another geographic area. For example, certain fish may appear on the species list because a project could affect downstream species. IPaC does not display listed species or critical habitats under the sole jurisdiction of NOAA Fisheries , as USFWS does not have the authority to speak on behalf of NOAA and the Department of Commerce. See the "Critical habitats" section below for those critical habitats that lie wholly or partially within your project area under this office's jurisdiction. Please contact the designated FWS office if you have questions. NOAA Fisheries, also known as the National Marine Fisheries Service (NMFS), is an office of the National Oceanic and Atmospheric Administration within the Department of Commerce. Mammals NAME STATUS Canada Lynx Lynx canadensis Population: Wherever Found in Contiguous U.S. There is final critical habitat for this species. The location of the critical habitat is not available. Species profile: https://ecos.fws.gov/ecp/species/3652 Threatened Birds NAME STATUS Mexican Spotted Owl Strix occidentalis lucida There is final critical habitat for this species. The location of the critical habitat is not available. Species profile: https://ecos.fws.gov/ecp/species/8196 Threatened Yellow-billed Cuckoo Coccyzus americanus Population: Western U.S. DPS There is final critical habitat for this species. The location of the critical habitat is not available. Species profile: https://ecos.fws.gov/ecp/species/3911 Threatened 1 02/01/2022 4 Fishes NAME STATUS Bonytail Gila elegans There is final critical habitat for this species. The location of the critical habitat is not available. Species profile: https://ecos.fws.gov/ecp/species/1377 Endangered Colorado Pikeminnow (=squawfish) Ptychocheilus lucius Population: Wherever found, except where listed as an experimental population There is final critical habitat for this species. The location of the critical habitat is not available. Species profile: https://ecos.fws.gov/ecp/species/3531 Endangered Humpback Chub Gila cypha There is final critical habitat for this species. The location of the critical habitat is not available. Species profile: https://ecos.fws.gov/ecp/species/3930 Threatened Razorback Sucker Xyrauchen texanus There is final critical habitat for this species. The location of the critical habitat is not available. Species profile: https://ecos.fws.gov/ecp/species/530 Endangered Insects NAME STATUS Monarch Butterfly Danaus plexippus No critical habitat has been designated for this species. Species profile: https://ecos.fws.gov/ecp/species/9743 Candidate Flowering Plants NAME STATUS Ute Ladies'-tresses Spiranthes diluvialis No critical habitat has been designated for this species. Species profile: https://ecos.fws.gov/ecp/species/2159 Threatened Critical habitats THERE ARE NO CRITICAL HABITATS WITHIN YOUR PROJECT AREA UNDER THIS OFFICE'S JURISDICTION. 02/01/2022 1 USFWS National Wildlife Refuge Lands And Fish Hatcheries Any activity proposed on lands managed by the National Wildlife Refuge system must undergo a 'Compatibility Determination' conducted by the Refuge. Please contact the individual Refuges to discuss any questions or concerns. THERE ARE NO REFUGE LANDS OR FISH HATCHERIES WITHIN YOUR PROJECT AREA. 02/01/2022 1 1. 2. 3. Migratory Birds Certain birds are protected under the Migratory Bird Treaty Act and the Bald and Golden Eagle Protection Act . Any person or organization who plans or conducts activities that may result in impacts to migratory birds, eagles, and their habitats should follow appropriate regulations and consider implementing appropriate conservation measures, as described below. The Migratory Birds Treaty Act of 1918. The Bald and Golden Eagle Protection Act of 1940. 50 C.F.R. Sec. 10.12 and 16 U.S.C. Sec. 668(a) The birds listed below are birds of particular concern either because they occur on the USFWS Birds of Conservation Concern (BCC) list or warrant special attention in your project location. To learn more about the levels of concern for birds on your list and how this list is generated, see the FAQ below. This is not a list of every bird you may find in this location, nor a guarantee that every bird on this list will be found in your project area. To see exact locations of where birders and the general public have sighted birds in and around your project area, visit the E-bird data mapping tool (Tip: enter your location, desired date range and a species on your list). For projects that occur off the Atlantic Coast, additional maps and models detailing the relative occurrence and abundance of bird species on your list are available. Links to additional information about Atlantic Coast birds, and other important information about your migratory bird list, including how to properly interpret and use your migratory bird report, can be found below. For guidance on when to schedule activities or implement avoidance and minimization measures to reduce impacts to migratory birds on your list, click on the PROBABILITY OF PRESENCE SUMMARY at the top of your list to see when these birds are most likely to be present and breeding in your project area. NAME BREEDING SEASON Bald Eagle Haliaeetus leucocephalus This is not a Bird of Conservation Concern (BCC) in this area, but warrants attention because of the Eagle Act or for potential susceptibilities in offshore areas from certain types of development or activities. https://ecos.fws.gov/ecp/species/1626 Breeds Dec 1 to Aug 31 Cassin's Finch Carpodacus cassinii This is a Bird of Conservation Concern (BCC) throughout its range in the continental USA and Alaska. https://ecos.fws.gov/ecp/species/9462 Breeds May 15 to Jul 15 1 2 02/01/2022 2 1. 2. 3. NAME BREEDING SEASON Evening Grosbeak Coccothraustes vespertinus This is a Bird of Conservation Concern (BCC) throughout its range in the continental USA and Alaska. Breeds May 15 to Aug 10 Lewis's Woodpecker Melanerpes lewis This is a Bird of Conservation Concern (BCC) throughout its range in the continental USA and Alaska. https://ecos.fws.gov/ecp/species/9408 Breeds Apr 20 to Sep 30 Probability Of Presence Summary The graphs below provide our best understanding of when birds of concern are most likely to be present in your project area. This information can be used to tailor and schedule your project activities to avoid or minimize impacts to birds. Please make sure you read and understand the FAQ "Proper Interpretation and Use of Your Migratory Bird Report" before using or attempting to interpret this report. Probability of Presence () Each green bar represents the bird's relative probability of presence in the 10km grid cell(s) your project overlaps during a particular week of the year. (A year is represented as 12 4-week months.) A taller bar indicates a higher probability of species presence. The survey effort (see below) can be used to establish a level of confidence in the presence score. One can have higher confidence in the presence score if the corresponding survey effort is also high. How is the probability of presence score calculated? The calculation is done in three steps: The probability of presence for each week is calculated as the number of survey events in the week where the species was detected divided by the total number of survey events for that week. For example, if in week 12 there were 20 survey events and the Spotted Towhee was found in 5 of them, the probability of presence of the Spotted Towhee in week 12 is 0.25. To properly present the pattern of presence across the year, the relative probability of presence is calculated. This is the probability of presence divided by the maximum probability of presence across all weeks. For example, imagine the probability of presence in week 20 for the Spotted Towhee is 0.05, and that the probability of presence at week 12 (0.25) is the maximum of any week of the year. The relative probability of presence on week 12 is 0.25/0.25 = 1; at week 20 it is 0.05/0.25 = 0.2. The relative probability of presence calculated in the previous step undergoes a statistical conversion so that all possible values fall between 0 and 10, inclusive. This is the probability of presence score. Breeding Season () Yellow bars denote a very liberal estimate of the time-frame inside which the bird breeds across its entire range. If there are no yellow bars shown for a bird, it does not breed in your project area. ■ ■ 02/01/2022 3 Ƒ Ƒ Ƒ QRGDWDVXUYH\HIIRUWEUHHGLQJVHDVRQSUREDELOLW\RISUHVHQFH Survey Effort () Vertical black lines superimposed on probability of presence bars indicate the number of surveys performed for that species in the 10km grid cell(s) your project area overlaps. The number of surveys is expressed as a range, for example, 33 to 64 surveys. No Data () A week is marked as having no data if there were no survey events for that week. Survey Timeframe Surveys from only the last 10 years are used in order to ensure delivery of currently relevant information. The exception to this is areas off the Atlantic coast, where bird returns are based on all years of available data, since data in these areas is currently much more sparse. SPECIES JAN FEB MAR APR MAY JUN JUL AUG SEP OCT NOV DEC Bald Eagle Non-BCC Vulnerable Cassin's Finch BCC Rangewide (CON) Evening Grosbeak BCC Rangewide (CON) Lewis's Woodpecker BCC Rangewide (CON) Additional information can be found using the following links: Birds of Conservation Concern http://www.fws.gov/birds/management/managed-species/ birds-of-conservation-concern.php Measures for avoiding and minimizing impacts to birds http://www.fws.gov/birds/ management/project-assessment-tools-and-guidance/ conservation-measures.php Nationwide conservation measures for birds http://www.fws.gov/migratorybirds/pdf/ management/nationwidestandardconservationmeasures.pdf Migratory Birds FAQ Tell me more about conservation measures I can implement to avoid or minimize impacts to migratory birds. ■ ■ I ----+ ---------------+-- -+ ---------------+-- 02/01/2022 4 Nationwide Conservation Measures describes measures that can help avoid and minimize impacts to all birds at any location year round. Implementation of these measures is particularly important when birds are most likely to occur in the project area. When birds may be breeding in the area, identifying the locations of any active nests and avoiding their destruction is a very helpful impact minimization measure. To see when birds are most likely to occur and be breeding in your project area, view the Probability of Presence Summary. Additional measures or permits may be advisable depending on the type of activity you are conducting and the type of infrastructure or bird species present on your project site. What does IPaC use to generate the migratory birds potentially occurring in my specified location? The Migratory Bird Resource List is comprised of USFWS Birds of Conservation Concern (BCC) and other species that may warrant special attention in your project location. The migratory bird list generated for your project is derived from data provided by the Avian Knowledge Network (AKN). The AKN data is based on a growing collection of survey, banding, and citizen science datasets and is queried and filtered to return a list of those birds reported as occurring in the 10km grid cell(s) which your project intersects, and that have been identified as warranting special attention because they are a BCC species in that area, an eagle (Eagle Act requirements may apply), or a species that has a particular vulnerability to offshore activities or development. Again, the Migratory Bird Resource list includes only a subset of birds that may occur in your project area. It is not representative of all birds that may occur in your project area. To get a list of all birds potentially present in your project area, please visit the AKN Phenology Tool. What does IPaC use to generate the probability of presence graphs for the migratory birds potentially occurring in my specified location? The probability of presence graphs associated with your migratory bird list are based on data provided by the Avian Knowledge Network (AKN). This data is derived from a growing collection of survey, banding, and citizen science datasets . Probability of presence data is continuously being updated as new and better information becomes available. To learn more about how the probability of presence graphs are produced and how to interpret them, go the Probability of Presence Summary and then click on the "Tell me about these graphs" link. How do I know if a bird is breeding, wintering, migrating or present year-round in my project area? To see what part of a particular bird's range your project area falls within (i.e. breeding, wintering, migrating or year-round), you may refer to the following resources: The Cornell Lab of Ornithology All About Birds Bird Guide, or (if you are unsuccessful in locating the bird of interest there), the Cornell Lab of Ornithology Neotropical Birds guide. If a bird on your migratory bird species list has a breeding season associated with it, if that bird does occur in your project area, there may be nests present at some point within the timeframe specified. If "Breeds elsewhere" is indicated, then the bird likely does not breed in your project area. What are the levels of concern for migratory birds? 02/01/2022 5 1. 2. 3. Migratory birds delivered through IPaC fall into the following distinct categories of concern: "BCC Rangewide" birds are Birds of Conservation Concern (BCC) that are of concern throughout their range anywhere within the USA (including Hawaii, the Pacific Islands, Puerto Rico, and the Virgin Islands); "BCC - BCR" birds are BCCs that are of concern only in particular Bird Conservation Regions (BCRs) in the continental USA; and "Non-BCC - Vulnerable" birds are not BCC species in your project area, but appear on your list either because of the Eagle Act requirements (for eagles) or (for non-eagles) potential susceptibilities in offshore areas from certain types of development or activities (e.g. offshore energy development or longline fishing). Although it is important to try to avoid and minimize impacts to all birds, efforts should be made, in particular, to avoid and minimize impacts to the birds on this list, especially eagles and BCC species of rangewide concern. For more information on conservation measures you can implement to help avoid and minimize migratory bird impacts and requirements for eagles, please see the FAQs for these topics. Details about birds that are potentially affected by offshore projects For additional details about the relative occurrence and abundance of both individual bird species and groups of bird species within your project area off the Atlantic Coast, please visit the Northeast Ocean Data Portal. The Portal also offers data and information about other taxa besides birds that may be helpful to you in your project review. Alternately, you may download the bird model results files underlying the portal maps through the NOAA NCCOS Integrative Statistical Modeling and Predictive Mapping of Marine Bird Distributions and Abundance on the Atlantic Outer Continental Shelf project webpage. Bird tracking data can also provide additional details about occurrence and habitat use throughout the year, including migration. Models relying on survey data may not include this information. For additional information on marine bird tracking data, see the Diving Bird Study and the nanotag studies or contact Caleb Spiegel or Pam Loring. What if I have eagles on my list? If your project has the potential to disturb or kill eagles, you may need to obtain a permit to avoid violating the Eagle Act should such impacts occur. Proper Interpretation and Use of Your Migratory Bird Report The migratory bird list generated is not a list of all birds in your project area, only a subset of birds of priority concern. To learn more about how your list is generated, and see options for identifying what other birds may be in your project area, please see the FAQ "What does IPaC use to generate the migratory birds potentially occurring in my specified location". Please be aware this report provides the "probability of presence" of birds within the 10 km grid cell(s) that overlap your project; not your exact project footprint. On the graphs provided, please also look carefully at the survey effort (indicated by the black vertical bar) and for the existence of the "no data" indicator (a red horizontal bar). A high survey effort is the key component. If the survey effort is high, then the probability of presence score can be viewed as more dependable. In contrast, a low survey effort bar or no data bar means a lack of data and, therefore, a lack of 02/01/2022 6 certainty about presence of the species. This list is not perfect; it is simply a starting point for identifying what birds of concern have the potential to be in your project area, when they might be there, and if they might be breeding (which means nests might be present). The list helps you know what to look for to confirm presence, and helps guide you in knowing when to implement conservation measures to avoid or minimize potential impacts from your project activities, should presence be confirmed. To learn more about conservation measures, visit the FAQ "Tell me about conservation measures I can implement to avoid or minimize impacts to migratory birds" at the bottom of your migratory bird trust resources page. 02/01/2022 1 Ƒ Wetlands Impacts to NWI wetlands and other aquatic habitats may be subject to regulation under Section 404 of the Clean Water Act, or other State/Federal statutes. For more information please contact the Regulatory Program of the local U.S. Army Corps of Engineers District. Please note that the NWI data being shown may be out of date. We are currently working to update our NWI data set. We recommend you verify these results with a site visit to determine the actual extent of wetlands on site. RIVERINE R4SBC Pre-Construction Notification, Nationwide Permit 39 April 2022 Royal Mini Storage West Glenwood (SME# 190050) SME Environmental, Inc. ATTACHMENT 4 Cultural Resources – Colorado OAHP Database Search Results 23017_sy HISTORY COLORADO Office of Archaeology and Historic Preservation 1200 Broadway, Denver, Colorado 80203 Sean Moore SME Environmental 679 E. 2nd Ave, Unit E2 Durango, CO 81301 August 26, 2020 Re: West Glenwood Springs Project; 190050 File Search No. 23017 At your request, the Office of Archaeology and Historic Preservation has conducted a search of the Colorado Inventory of Cultural Resources within the area shown in the provided shapefiles, located in the following areas: PM T R S 6th 6S 90W 1 0 sites and 1 surveys were located in the designated area(s). If information on any district, site, building, structure, or object in the project area was found, detailed information follows the summary. If no properties were found, but surveys are known to have been conducted in the project area, survey information follows the summary. We do not have complete information on surveys conducted in Colorado, and our site files cannot be considered complete because most of the state has not been surveyed for cultural resources. There is the possibility that as yet unidentified cultural resources exist within the proposed impact area. Our letter should not be interpreted as formal consultation under Section 106 of the National Historic Preservation Act (36 CFR 800) or the Colorado Register of Historic Places (CRS 24-80.1). In the event that there is federal or state agency involvement, please note that it is the responsibility of the agencies to meet the requirements of these regulations. We look forward to consulting with you regarding the effect of the proposed project on significant cultural resources in accordance with the Advisory Council on Historic Preservation regulations titled “Protection of Historic Properties” or the Colorado Register of Historic Places, as applicable (http://www.historycolorado.org/oahp/consultation-guidance). If you have any questions, please contact the Office of Archaeology and Historic Preservation at (303) 866-3392. Thank you for your interest in Colorado's cultural heritage. Steve Turner, AIA State Historic Preservation Officer *Information regarding significant archaeological resources is excluded from the Freedom of Information Act. Therefore, legal locations of these resources must not be included in documents for public distribution. HISTORY COLORADO Office of Archaeology and Historic Preservation 1200 Broadway, Denver, Colorado 80203 Sean Moore SME Environmental 679 E. 2nd Ave, Unit E2 Durango, CO 81301 January 28, 2022 Re: Royal Mini Storage West Glenwood; 190050 File Search No. 24439 At your request, the Office of Archaeology and Historic Preservation has conducted a search of the Colorado Inventory of Cultural Resources within the area shown in the provided shapefiles, located in the following areas: PM T R S 6th 6S 89W 6 6th 6S 90W 1 0 sites and 1 surveys were located in the designated area(s). If information on any district, site, building, structure, or object in the project area was found, detailed information follows the summary. If no properties were found, but surveys are known to have been conducted in the project area, survey information follows the summary. We do not have complete information on surveys conducted in Colorado, and our site files cannot be considered complete because most of the state has not been surveyed for cultural resources. There is the possibility that as yet unidentified cultural resources exist within the proposed impact area. Our letter should not be interpreted as formal consultation under Section 106 of the National Historic Preservation Act (36 CFR 800) or the Colorado Register of Historic Places (CRS 24-80.1). In the event that there is federal or state agency involvement, please note that it is the responsibility of the agencies to meet the requirements of these regulations. We look forward to consulting with you regarding the effect of the proposed project on significant cultural resources in accordance with the Advisory Council on Historic Preservation regulations titled “Protection of Historic Properties” or the Colorado Register of Historic Places, as applicable (http://www.historycolorado.org/oahp/consultation-guidance). If you have any questions, please contact the Office of Archaeology and Historic Preservation at (303) 866-3392. Thank you for your interest in Colorado's cultural heritage. Dawn DiPrince State Historic Preservation Officer *Information regarding significant archaeological resources is excluded from the Freedom of Information Act. Therefore, legal locations of these resources must not be included in documents for public distribution. 24439_sy Wildlife Impact Report April 4, 2022 Wildlife Impact Report Prepared for: The Land Studio 365 River Bend Way Glenwood Springs, CO 81601 970-927-3690 Prepared by: SGM 118 West Sixth Street, Suite 200 Glenwood Springs, CO 81601 970-384-9017 #2022-191.001 Royal Mini-Storage Project Garfield County, Colorado www.sgm-inc.com 6 SGM Royal Mini-Storage Wildlife Impact Report i Table of Contents 1 Introduction 1 1.1 Summary of Findings 1 2 Project Description 3 2.1 Project Setting 3 3 Impacts to Vegetation and Wildlife Resources 5 3.1 Vegetation 5 3.2 Federally Listed Species 5 3.2.1 Bald Eagle 6 3.3 Big Game Species 8 3.3.1 Elk 8 3.3.2 Mule Deer 11 3.3.3 Black Bear 14 3.4 General Wildlife Impacts 16 4 References Cited 17 LIST OF TABLES Table 1. Federally Listed Species Considered 5 LIST OF FIGURES Figure 1 – Vicinity Map 2 Figure 2 – Royal Mini-Storage Plan 4 Figure 3 - Bald Eagle Habitats 7 Figure 4 - Elk Habitats 10 Figure 5 - Mule Deer Habitats 13 Figure 6 – Black Bear Habitats 15 LIST OF APPENDICES Appendix A – CPW Habitat Definitions 38 Royal Mini-Storage Wildlife and Noxious Weed Report 1 1 Introduction This wildlife impact report was prepared at the request of The Land Studio and MMME WG, LLC (the “Applicant”), who is seeking a Land Use Change Permit to develop the Royal Mini-Storage project (“Project”), on a 38-acre parcel, in Garfield County, Colorado 6/10 of a mile west of Glenwood Springs. The parcel is located at the end of US Highway 6 and 24 (Figure 1). The parcel is undeveloped with pinion juniper woodlands, dryland pastures, and other native vegetation types. During the site visit, earth moving equipment was on site and portions of the vegetation have been removed. The purpose of this report is to document conditions as they exist at this time, to discuss the potential impacts of the proposed project on wildlife. 1.1 Summary of Findings • Noxious weeds will need to be managed; early and aggressive treatment will be needed to prevent their spread both on and off the facility. • There are no Threatened or Endangered Species issues associated with the site. • The project would be in elk and mule deer winter ranges, bear human conflict area, and a bald eagle nest is within ½ mile of the property. Royal Mini-Storage Wildlife Impact Report 2 Figure 1 – Vicinity Map VICINITY MAP Royal Mm, Storage 4589W ....., Property Boundary "\.,/-US or State Highway County Highway "\.,/-Local Road _,.:--1 L,__r' Municipal Boundary □ Township/Range/Section 5589.SW ss 89W. ['.] Private Land ['.] BLM Land ['.] USFS Land ['.] State Land 0 1 E----------3 SCALE: 1 in • 2 miles Royal Mini-Storage Wildlife Impact Report 3 2 Project Description The proposed project is to construct a mini-storage facility on two parcels which total approximately 38 acres for the overall site. The site is located near Storm King Mountain, north of I-70, east of mile marker 113. The Royal Mini Storage facility will contain approximately 118,400 square feet of storage to be developed in three phases with construction beginning in the fall of 2022 and opening for business in March of 2023. An outdoor storage area will be provided as part of the proposed storage facility and will be surrounded with an 8-foot screened fence. The buildings will be single story. Two employee housing units are proposed as part of this application, one is an existing residential home, the other will be a new residence. Each home will be approximately 1500 square feet. Access to the storage facility will be from Highway 6 & 24. The applicant intends to provide improvements to the access. 2.1 Project Setting The property generally has two separate vegetation types. A large portion of the lower property is dominated by pastures with gently sloping topography, located on alluvial/colluvial material which has been leveled by deposition. Pasture areas are dominated by agricultural cultivars including smooth brome (Bromus inermis), orchardgrass (Dactylis glomerata), western wheatgrass (Pascopyrum smithii), as well as some native grasses such as Indian rice grass (Achnatherum hymenoides), and green needle grass (Nassella viridula). The steep slopes above the pastures are dominated by pinyon-juniper woodlands (Pinus edulis and Juniperus scopulorum) intermixed with Gambel oak (Quercus gambelii), and mountain mahogany (Cercocarpus montanus and C. ledifolius); these areas have minimal understory vegetation consisting primarily of Indian rice grass and green needle grass. A portion of the property has already been disturbed by previous activities including stockpiling and earthwork related to MMME WG/Gould Construction work. There are no wetlands, creeks or streams, or other hydric features on the parcel. The draw running through the center of the property does not show consistent flow, and does not support a bed or banks, or an o rdinary high-water mark. Land use adjacent to the project parcel to the west and north consists of BLM managed lands, which are dominated by pinyon-juniper woodlands. Land on the eastern boundary of the parcel is privately owned campground called Ami’s Acres. Land use south of the project parcel is part of the Interstate 70 highway corridor/right-of-way. Just south of interstate highway is the Colorado River. Royal Mini-Storage Wildlife Impact Report 4 Figure 2 – Royal Mini-Storage Plan Notes: 1. R,prap or cobble, Provide a one-pound sample of material tor review and approval. 2. Warranty plants and trees for one year aner final acceptance. Replace dead or dying materials not ,n vigorous, lhnv,ng cond1110n as soon as weather permits. 3 Delermine locations of underground ut1h11es and perform work In a manner which wil avoid po6S ble damage 4 PlanlS shall be specimen quaflty, typlcal of their species or variety 5. Plant trees and shrubs ,n pots 12" larger than tree ball, backfill with a m0< of 2 parts lopso,I and 1 part Nutr►Mulch. 6. Install 'Weed Restnc:tor Fabnc" between so,I and crushed granite or cobble. 7. Amend so,f ,n perennial and shrub plant,ng beds with 3 cub<e yards of weed free compost for every 1,000 s.f. of planting bed 8. Boulders shall be angular in shape, 112 ton 10 1 ton In size 9. All plant malerials to be lrrigaled With a drip Irrigation system. All seed or sod areas 10 be irrigated with an underground system utilizing roiatlng sprinkler nozzels 20' Riprap or cobble buffer Revegetation notes All areas disturbed during oonstruc:tlon will be revegeiated acc:o1dIng to the tonow,ng cntena Ourn,g oonstructIon, eros10n which may pose a threat 10 surround Ing properties or walerways will be conlained Uvough the use of temporary eros,on control measures as deemed neeessary Revegetat,on ,or d1stur1led areas shall convnen,oe ,n the faD, pnor to the first ma1or snowfall, or ear1y spnng when site oonditions allow Eros,on Control measures are a,med at oontrollmg/00nfin1ng sediment v11thin or near the area of d'5turbance. The long term stability of these areas WIii depend on the es1ab11Shmen1 of aJll"oprlate ground cover vegetation The pomary goal of the revegelation effort Is to protec:t water quafity that WIii require a sturdy ground cover as soon as possible. All natural vegetallon o remain shall be protected Exposure of sod 10 erosion by removal or d1slurban,oe of vegetation shall be hmoted to lhe area required for 1mmed1a1e construction operabons and for the shortest pract,cal period of time. All dJSturbed areas shall be seeded or covered with rip-fap. Use Rlvendell's native low grow Pijkin County seed mb<. All topsoil shall be salvaged from disturbed areas, stockpiled and re-spread proor to revegetabon. Topsoil should not be re-spread on areas of the sae proposed for Mure building. Seed shall be dnlled or otherwise mechanically ,noorporated WllO the soil ("larmed") or shall be hydraulically applied and followed by application of hydraulically applied mulch or straw Straw mulch shall be secured in place with a hydraulically applied tackifoer "C 0 0 ~ 0 a, "C -ns (!) ... 0 ..... ti) 0 a, (.) 3: ~ a, C C) ::s ns o ou ..... "C "'-a, c·-·-'t: ~ ns _(!) ns >. 0 0:: L1 Royal Mini-Storage Wildlife Impact Report 5 3 Impacts to Vegetation and Wildlife Resources 3.1 Vegetation The majority of the proposed project construction would occur in previously disturbed areas (primarily dryland pastures) leaving the majority of the pinyon juniper woodlands in place. These woodlands provide year-round habitat for a variety of wildlife species, including nesting birds, small mammals, elk, mule deer, carnivores, and other wildlife groups. 3.2 Federally Listed Species Information on species status, distribution, and ecology was derived from U.S. Fish and Wildlife Service (USFWS) recovery plans, geographic information system (GIS) databases, various scientific studies and reports, and field reviews. The wildlife species assessments have been mapped and described following all applicable practices of Colorado Parks and Wildlife (CPW). Listed or candidate wildlife species considered and evaluated for this assessment include those identified by the USFWS as potentially occurring in the development areas of the proposed Project area. While all listed species were initially considered, species where there would be No effect from the project were eliminated from further consideration. The decision to eliminate a species from consideration was based on known range distributions and/or complete habitat incompatibility (Table 1). Table 1. Federally Listed Species Considered Species1 Occurrence Habitat Association Potential Habitat in Project Area? Potential Impact/Issue? MAMMALS Canada Lynx (FT) (Lynx canadensis) High mountain areas with large expanses of conifer forests in Colorado Spruce/fir and lodgepole pine forests, sometimes aspen forests No No Gray Wolf (FE) (Canis lupus) Northern counties, no packs in state at this time Shrublands, forests and areas away from human habitation No No BIRDS Mexican spotted-owl (FT, ST) Strix occidentalis lucida Southwest Colorado, and along Wet Mountains, Rampart Range Deep shaded canyons with closed canopy conifers and cliffs No No Yellow-billed cuckoo (FT) Coccyzus americanus North Fork of Gunnison, Colorado, Dolores, Yampa and Rio Grande rivers Large cottonwood stands along larger rivers No No FISHES Bonytail chub (FE, SE) Gila elegans No known populations remain in Colorado Large, swift-flowing waters of the Colorado River system No No Colorado pikeminnow (FE, ST) Ptychocheilus lucius Colorado, Dolores, Green, Gunnison, San Juan, White and Yampa Large, swift-flowing rivers that are seasonally turbid with warm backwaters No No Humpback chub (FE, ST) Gila cypha Green, Yampa and Colorado Rivers Pools and eddies in areas of fast- flowing, deep, turbid water, often associated with cliffs and boulders No No Razorback sucker (FE, SE) Xyrauchen texanus Lower Yampa and lower Colorado Rivers Deep, clear to turbid waters of large rivers and reservoirs, with silt, mud, or gravel substrate. Quiet, soft-bottom river backwaters No No Royal Mini-Storage Wildlife Impact Report 6 Species1 Occurrence Habitat Association Potential Habitat in Project Area? Potential Impact/Issue? PLANTS Ute Ladies’-tresses (FT) Spiranthese diluvialis Northwest Colorado, the Roaring Fork Valley, and the northern Front Range Moist meadows, seasonal river terraces, and irrigation channels below 7000 feet in elevation No No Source: CPW 2015 FE = Federally Endangered; FT = Federally Threatened; SE = State Endangered; ST = State Threatened; SGCN = Species of Greatest Conservation Need The Property does not support suitable habitat and is not within the range of any other listed species. This project would have no effect on any Federally listed species. The project is not within any Proposed or existing Critical Habitats; this project would have no effect on any Proposed or existing Critical Habitats. 3.2.1 Bald Eagle Bald eagles (Haliaeetus leucocephalus) are federally protected by the Bald and Golden Eagle Protection Act of 1940. They are also protected under the Migratory Bird Treaty Act of 1918. In addition, CPW tracks bald eagle populations, nesting sites, roosting habitat, and foraging areas and has developed protective stipulations for the species, with specific recommendations for nests, winter night roosts, and hunting perches (CPW 2008). As currently mapped, the Project is located within bald eagle Winter Range and in Winter Foraging habitats which generally coincide with big game winter ranges, where bald eagles opportunistically forage on winter- killed big game. The Project is approximately 0.4-mile from the nearest roost site and is within 1/2 mile from the nearest nesting areas along the Roaring Fork River (Figure 3). No nests are currently located within or adjacent to the Project area. There are no habitats of the type preferred by nesting eagles (large deciduous tree adjacent to flowing water) on the Property. Bald eagles occurring in the Project area would likely be limited to scavenging on winter-killed big game species. No significant impacts to eagles are anticipated given there are no suitable perching sites or nesting trees in the project area, and development of the project is not anticipated to change the potential availability of winter-killed big game species. The presence of the mini-storage facility would not deter bald eagles from scavenging on winter killed big game; once constructed the facility would not make noise and have rapidly moving components. Bald eagles would still be able to scavenge with little disturbance. The existing nest site is separated from the proposed mini-storage facility by Interstate 70 and the Colorado River and is adjacent to the Union Pacific railroad. Rafters and other river users float by the nest on a daily basis aside from the coldest months in winter. As such, the nest site sees daily loud disturbances and human activity, and the construction and use of the mini-storage site is not anticipated to introduce a notably new or novel impact that the bald eagles already have become accustomed to. The project is not anticipated to result in any significant or meaningful impacts to the bald eagle nest site. The project is not anticipated to have any measurable or meaningful impacts to bald eagle’s ability to roost, nest, or forage in the area, and the project would have no impact on bald eagle populations. Royal Mini Storage Wildlife Impact Report 7 Figure 3 - Bald Eagle Habitats BALD EAGLE HABITAT AREAS Royal Mm, Storage ...._,-Property Boundary ~-1 C,.-_,' Municipal Boundary D Township/Range/Section Bald Eagle Habitat Areas ~ Bald Eagle Winter Concentration Area Qi> Bald Eagle Nest Sites ~ Bald Eagle Summer Forage [:? Bald Eagle Winter Range ~ Bald Eagle Roost Site ,,ww.54.hail11:0 ~..-..m,u,o, r.ow.,.., Royal Mini-Storage Wildlife Impact Report 8 3.3 Big Game Species 3.3.1 Elk In the southern Rocky Mountains, as elsewhere in North America, elk are often associated with edge (ecotone) habitats where forested and meadow/shrubland systems are intermingled. During much of the year, elk are typically found near edges where forests grow adjacent to parks, meadows, or alpine tundra (Skovlin 1982, Fitzgerald et al. 1994). During the summer months, elk may spend significant amounts of time feeding in open alpine environments above tree line. Use of alpine habitats is thought to be associated with the cooler temperatures, persistent snowbanks, and breezy conditions that keep bothersome flying insects to a minimum (Adams 1982, Lyon and Ward 1982). During the winter elk may congregate in low elevation sagebrush expanses, pinyon and juniper woodlands, irrigated meadows, and other open habitats that are significant distances from forested cover (Lyon and Ward 1982). On winter ranges, elk form mixed herds of bulls, cows, and calves (Fitzgerald et al. 1994), but in the more developed areas in Colorado, bulls may avoid traditional winter ranges that are near high-use roads, homes, and other human developments (B. Andree, CPW pers. comm. 2006, Dodd et al. 2007). Generally, elk feed at twilight and at night, but they readily forage and disperse through the daylight hours. Most elk mortality is due to predation on calves, hunting, and winter starvation. Localized mortality from vehicle strikes may also produce noticeable impacts on herds where traffic exceeds 1,000 VPD and where traffic travels at high speeds (Gagnon et al. 2007). Elk are generalist feeders, but usually prefer to graze on grasses, grass-like plants, and forbs during the non- winter months (Nelson and Leege 1982, Fitzgerald et al. 1984). The specific diet for elk in a particular locality is largely determined by the season and palatability of available forage plants (Nelson and Leege 1982). In Colorado, elk show a clear preference for grasses and grass-like plants (Hoover and Wills 1984). Browse species can also vary by site and palatability of available plants. Shrubs, deciduous trees, and sometimes conifers compose much of the winter diet when snow depth limits access to grasses, sedges, and forbs (Nelson and Leege 1982). On Colorado winter ranges, oakbrush, aspen (Populus tremuloides), serviceberry (Amelanchier spp.), sagebrush, and snowberry (Symphorocarpos spp.) are the major browse species used by elk (Hoover and Wills 1984). Locally heavy feeding on aspen bark during the winter and spring can be very significant and can leave long-lasting impacts on aspen stands. Issues of Concern. CPW staff have indicated that most herds near mountain communities have decreased in size from 50 to 60 percent since their peak population sizes in the mid- to late-1990s. While direct habitat loss has slowed from the 2000s, there has been a widespread increase in outdoor uses around mountain communities, primarily through increased trail construction, and now almost year-round recreation (C. Wescoatt and B. Andree, CPW District Wildlife Managers, as cited in Vail Daily, 6/16/2018; J. Mao, CPW Terrestrial Biologist, pers. comm. 10/10/2018, M. Yamashita 12/10/2020). There is no single definitive activity or habitat impact that can be strongly linked to elk population declines, but the current hypothesis is that the long-term reduction in winter ranges and increased year-round human pressure (primarily through recreation) in a variety of habitats are having cumulative impacts at a level where elk’s ability to produce viable numbers of calves is unable to replace yearly mortality (J. Mao pers. comm. 10/10/2018). The Project area occurs at the southern end of a large area of CPW-mapped Severe Winter Range (Figure 4), which encompass much of the Colorado River Valley. As snow accumulates during the early winter, elk are slowly pushed to lower elevations, and likely congregating on more southerly exposures where snow depths are shallower, and browse is more available. Royal Mini-Storage Wildlife Impact Report 9 Impact Analysis. Development of the mini-storage facility would no t impact elk summer range habitats, or any elk Production (calving) areas; during the summer elk utilize much higher elevations. The primary impacts would be during the winter months, as discussed below. Dirtwork in the area is already ongoing. The actual construction period of the buildings would begin in the late summer or early fall of 2022, when elk are not in the area. Once elk begin to filter into the area (in November and early December, depending on snowfall), the daily human activities at the site, including noise, motion, equipment operations, traffic, lighting, snowplowing, etc., would preclude most elk use from within and around the project site. While elk sometimes avoid areas of high human activity by up to ½ mile, they can also become accustomed to some levels of regular or “anticipatory” human activities, especially when those activities are limited to a relatively confined area. Regardless, for the purpose of this report, it is assumed that most available winter ranges in and around the construction area would see diminished elk use during the one winter season of construction. However, elk may utilize or linger in the pinyon-juniper woodlands north of the proposed facility. It is likely that elk would stay high up on the hillsides, away from loud noises and activities, and only venture near the site during the nightime hours. After construction, the mini-storage facility area would not provide any suitable habitat, and the security fencing would not allow any animals to move through the area. Within the facility, there would likely be relatively low levels of human activity in the winter months, when elk would be in otherwise available habitats around the facility. More intensive maintenance activities would occur in the summer, when the site is snow free, and therefore more extensive human activities would be avoided during the winter season. Snow p lowing, and general light-maintenance and operation work would occur in the winter. This low level of human activity, confined to the mini-storage facility, may produce some temporary avoidance of otherwise available habitats around the facility, but elk would likely resume foraging or loafing around the facility. While it is unlikely that development of the Project would result in any noticeable or significantly detrimental impacts to elk at the herd level, the development would cumulatively reduce winter range foraging areas, which is a very important habitat component given the poor condition most elk are in during the winter season and would cumulatively reduce available elk winter range habitats. Royal Mini Storage Wildlife Impact Report 10 Figure 4 - Elk Habitats ELK HABITAT AREAS Royal Morn Storage °" Property Boundary (~~1 Municipal Boundary 0 Township/Range/Section Elk Habitat Areas Elk Winter Range ~ Elk Severe Winter Range ~ Elk Winter Concentration Area ~ Elk Highway Cossings ~ Elk Production Area 0 02 E----------3 SCALE: 1 inch• 2,250 foot Royal Mini Storage Wildlife Impact Report 11 3.3.2 Mule Deer Mule deer occur throughout Colorado and are relatively common in the west. Mule deer occupy all ecosystems in Colorado from grasslands to alpine tundra, but they reach their greatest densities in shrublands on rough, broken terrain, which provides abundant browse and cover. Their wide distribution and general adaptability make for broad diets. However, deer are considered to be browsers (primarily eating shrubs and twigs), as opposed to grazers (which eat mostly grasses). In Colorado the winter diets of mule deer consist of browse from a variety of trees, shrubs (74%) and grasses and forbs (26%), depending on local browse availability. In the spring and summer, browse contributes around 50% of the diet, and forbs and grasses make up the remainder (Fitzgerald et al. 1994). Browse use increases again in the fall to 60% and forb consumption decreases to 30% (Fitzgerald et al. 1994). Several studies in Colorado have indicated that diets containing 30% or more of sagebrush or juniper (Sabina spp.) reduce rumen microbes and are therefore deleterious (Carpenter 1976, Nagy and Tengerdy 1967, Nagy et al. 1964, Alldredge et al. 1974). When heavy snows bury grasses and forbs on rangelands and force mule deer to consume high amounts of sage and juniper, mortality rates increase due to malnutrition. Mule deer are mostly nocturnal and crepuscular in the warmer summer months and become more diurnal during winter. Activity depends on local conditions including temperature, season, weather, and forage. Over much of Colorado the species is migratory, summering at higher elevations and moving downslope to winter ranges. In some areas of Colorado migrations may be over 55 miles, but in most areas, migrations are closer to about 5 miles. The routes followed are often habitual, and deer show a certain amount of fidelity to these routes. Snow depths of 8 to 16 inches appear to trigger fall movements, and depths over 3 feet prevent use of an area (Loveless 1967). In some areas of northwestern Colorado mule deer begin migrations before snow accumulation (Garrott et al. 1987, as cited in Fitzgerald et al. 1994). These authors suggest that better-quality forage on winter range at that time of year triggers the movements. Throughout the winter mule deer will move about winter ranges, depending on snowfall and snow-melting events, but prefer to linger on more south-facing slopes where snow depth is shallowest. Spring and summer ranges are most typically a mosaic of meadows, aspen woodlands, alpine tundra and Krummholz, or montane forest edges. Montane forests and pinyon-juniper woodlands with good shrubby understories are often favored winter ranges. Because of the mule deer’s seasonal migratory movements, estimation of home ranges is somewhat difficult; however, deer appear to be seasonally sedentary, staying within areas of 100 to 2,200 acres. In areas where the animals do not migrate significant distances, annual home ranges are 1,700 acres to 5,400 acres (Mackie et al. 1982). Migrating individuals show strong winter and summer range site fidelity. Mortality in mule deer varies with age class and region. In Colorado, annual fawn mortality can vary as much as from 27% to 67% (Anderson and Bowden 1977). Fawn mortality is due to predation and starvation. Larger fawns are more likely to survive, and smaller fawns are more likely to starve. However, predators will take any size of fawn. Winter mortality of fawns may approach 75% annually. Mortality of adult deer is mostly from hunting and starvation (Carpenter 1976). Predators include coyotes, bobcats, golden eagles, mountain lions, black bears, and domestic dogs. Locally, coyote and mountain lion predation on fawns can account for significant mortality within populations. Fawns comprise about half of the yearly mortality; while mature females and bucks comprise the remaining 15% and 35%, of the annual mortality, respectively. Similar to elk, impacts to mule deer from human activities, recreational activities, trails and dogs have been well studied and documented in the scientific literature. Issues of Concern. Historically, mule deer would have utilized a wide swath of habitat throughout the Colorado River Valley, but development and conversion of habitats to residential areas has constrained most movement to areas with less disturbance, where natural topography, native shrublands and an absence of development Royal Mini Storage Wildlife Impact Report 12 creates preferable conditions. While conversion of shrublands to pastures and residential areas has removed some important habitat components, mule deer can continue to use the edges of residential areas. The presence of existing residential developments in close proximity to the project have compounded a situation where mule deer movement and habitat in the immediate vicinity has been impacted. Mule deer use of the project area likely occurs year-round. Similar to elk, the presence of other development within and adjacent to the project area likely has reduced habitat effectiveness across portions of the Property, and mule deer use likely avoids areas with high levels of human activity. CPW has mapped the project as being adjacent to a Highway Crossing Area, and approximately 2/3 of the site falls within Severe Winter Range area (Figure 5). Impact Analysis. Mule deer are likely in the area year-round, and therefore construction would cause mule deer to avoid the immediate project area, at least during the daytime hours (deer may still use areas near the construction zone at night). After construction, the daily site visits by staff and mini-storage clients would not result in a significant impact. Development of the Project would convert approximately 22-acres of native and previously disturbed habitats to “non-habitat”, given the presence of the security fence, and would also reduce habitat connectivity across the parcel. While it is unknown how many mule deer utilize winter range habitats in the area, any losses of winter range habitat can be concerning, and would have cumulatively negative impacts on mule deer winter range. CMC Spring Valley Solar PV Impact Analysis Report 13 Figure 5 - Mule Deer Habitats MULE DEER HABITAT AREAS Royal Min, Storage ..._, Property Boundary --, (:°,.-_,' Municipal Boundary D Township/Range/Section Mule Deer Habitat Areas Mule Deer Winter Range ~ Mule Deer Severe Winter Range ~ Mule Deer Winter Concentration Area ~ Mule Deer Highway Cossings fz;> Mule Deer Production Area 0 0.2 E----------3 SCALE: 1 inch • 2,250 foOI Royal Mini Storage Wildlife Impact Report 14 3.3.3 Black Bear Black bear (Ursus americanus) has become a significant wildlife management issue in the State of Colorado. Bears are commonly supplementing their diets by raiding garbage cans, breaking into homes, and becoming a hazard and a nuisance. Habitat on the Property itself is dominated by pinyon-juniper woodlands and dray pastures, which do not currently provide quality foraging opportunities for bears. However, nearby mixed mountain shrublands and oakbrush habitats do provide good habitat. The eastern portion of the project area falls within the Human Conflict Areas. The majority of the project parcels fall outside the Fall Concentration area (Figure 6). Impact Analysis. This development would have minor to insignificant impacts on bear populations or bear habitat availability, but black bears are likely to be in the area. The Project will need to ensure trash is not available during the construction, or operations phase of this project. The following measures will be implemented to reduce potential bear problems: 1) There should be no dumps that have edible materials associated with construction and post- construction activities. 2) Garbage should be placed in bear-proof dumpsters, individual bearproof trash containers, or kept in trash cans inside closed buildings. Royal Mini Storage Wildlife Impact Report 15 Figure 6 – Black Bear Habitats 6590W 11 12 BLACK BEAR HABITAT AREAS Royal Mon, Storage " Property Boundary (~~] Municipal Boundary D Township/Range/Section Black Bear Habitat Areas ~ Black Bear Human Conflict Area Black Bear Fall Concentration 0 0.2 E----------3 SCALE: 1 inch• 2,250 faot Royal Mini Storage Wildlife Impact Report 16 3.4 General Wildlife Impacts The following section discusses considerations to minimize the potential impacts to wildlife from the proposed development. Many of these recommendations are considered to be “best management practices” for wildlife, which would allow for continued wildlife use of areas within the development. Lighting: Because the area may still see use by mule deer and elk around the periphery at night, nighttime lighting of the Property is not recommended. Down-cast lighting, when needed, is recommended. Fencing: The applicant proposes to install an eight-foot-tall, screened fence for and security reasons in portions of the mini-storage facility. Aside from this fencing, the application should consider minimizing other fencing. The applicant should consider installing one-way “escape doors” for small mammals that get trapped in the facility. Landscaping & Revegetation: Because the surrounding area may still see some use as winter range, reclamation of infrastructure routes and temporarily disturbed areas should occur using similar native plant species and vegetation profiles. Noxious weeds should be treated aggressively in the first few years after construction to minimize weed spread that would impact native vegetation and thus minimize impacts on winter range and increase the success of revegetation activities. Domestic Dogs: Dogs can have a significant impact on wildlife and the ability for wildlife to effectively use otherwise-available habitats. Dogs can chase and kill wildlife, or so exhaust and injure wildlife that it dies later. To minimize the impacts of dogs on wildlife, dogs should be prohibited from running loose on the property, including contractor’s dogs. Royal Mini Storage Wildlife Impact Report 17 4 References Cited Adams, A.W. 1982. Migration (Chapter 7), in Thomas, J.W. and D.E. Toweill, eds. Elk of North America: ecology and conservation. Stackpole Books. Harrisburg, PA. Alldredge, A.W., J.F. Lipscomb, and F.W. Whicker. 1974. Forage intake rates of mule deer estimated with fallout cersium-137. J. Wildl. Mgmnt., 38:508-516. Anderson, A.E. and D.C. Bowden. 1977. Mule deer-coyote interactions. Pp. 15-16 in Colorado Game Res. Review, 1975-1976 (O.B. Cope, ed.). Colorado Div. Wildl., Ft. Collins, CO. 73pp. Boyatt, P. 2021 Personal communications, 1/26/2021. CPW District Wildlife Manager. Glenwood Springs, CO. Carpenter, L.H. 1976. Nitrogen-herbicide effects on sagebrush deer range. Unpubl. Ph.D. dissertation, Colorado State University, Ft. Collins, C). 159pp. Colorado Parks and Wildlife (CPW), Recommended Buffer Zones and Seasonal Restrictions for Colorado Raptors. 2002, revised 2008. Available at: https://cpw.state.co.us/Documents/WildlifeSpecies/LivingWithWildlife/RaptorBufferGuidelines2008.p df, accessed January 2019. Colorado Parks and Wildlife. 2015. State Wildlife Action Plan. Denver, CO. Dodd, N.L., J.W. Gagnon, S. Boe, and R.E. Schweinsburg. 2007. Assessment of Elk Highway Permeability by Using Global Positioning System Telemetry. The Journal of Wildlife Management, 71(4):1107-1117; 2007). Fitzgerald, J.P., C.A. Meaney and D.M. Armstrong. 1994. Mammals of Colorado. Denver Museum of Natural History. University Press of Colorado. P.O. Box 849, Niwot, CO 80544. Gagnon, J.W., T.C. Theimer, N.L. Dodd, S. Boe, and R.E. Schweinsburg. 2007. Traffic Volume Alters Elk Distribution and Highway Crossings in Arizona. Journal of Wildlife Management. 71(7):2318-2323; 2007. Hoover, R. L. and D. L. Wills, eds. 1984. Managing forested lands for wildlife. Published by Colorado Parks and Wildlife, Denver, CO. 459pp. Loveless, C.M. 1967. Ecological characteristics of a mule deer winter range. Tech. Bull., Colorado Div. Game, Fish and Parks, 20:1-124. Lyon, L.J. and A.L. Ward. 1982. Elk and land management. Pages 443-477 in J.W. Thomas and D.E. Toweill, eds. Elk of North America: Ecology and Management. Smithsonian Institution Press. Washington, D.C. Mackie, R.J., K.L. Hamlin, and D.F. Pac. 1982. Mule deer. Pp. 862-877, in wild mammals of North America: biology, management, and economics (J.A. Chapman and G.A. Feldhamer, eds.) Johns Hopkins Univ. Press. Baltimore, 1147pp. Mao, J. 2018. Personal Communications. Colorado Parks and Wildlife Terrestrial Biologist. Glenwood Springs, CO. 10/10/2018. Nagy, J.G. and R.P. Tengerdy. 1967. Antibacterial action of essential oils of Artemisiaas an ecological factor II. Antibacterial action ofthe volatile oils of Artemisia tridentata(big sagebrush) on bacteria from the rumen of mule deer. Appl. Microbiology. 16:441-444. Royal Mini Storage Wildlife Impact Report 18 Nelson, J.R. and T.A. Leege. 1982. Nutritional requirements and food habits. Pages 323-367 in J.W. Thomas and D.E. Toweill, eds. Elk of North America: ecology and management. Stackpole Books, Harrisburg, PA. Neumann, D. 2021. Personal communications, 1/26/2021. CPW Land Use Specialist, Norwest Region. Glenwood Springs, CO. U.S. Fish and Wildlife Service. 1980. Determination that the Bonytail Chub (Gila elegans) is an Endangered Species. Federal Register 45(80):27710-27713. U.S. Fish and Wildlife Service. 1990. Humpback Chub Recovery Plan. U.S. Fish and Wildlife Service, Denver, Colorado. U.S. Fish and Wildlife Service. 1991. Endangered and Threatened Wildlife and Plants: the Razorback Sucker (Xyrauchan texanus) Determined to be an Endangered Species. Final Rule. Federal Register 56(205):54957-54967. U.S. Fish and Wildlife Service. 1994. Endangered and Threatened Wildlife and Plants; Determination of Critical Habitat for the Colorado River Endangered Fishes: Razorback Sucker, Colorado Squawfish, Humpback Chub, and Bonytail Chub. Federal Register 59(54):13374-13400. U.S. Fish and Wildlife Service. 1999. Final Programmatic Biological Opinion (Four Colorado River Endangered Fish Species). US Fish and Wildlife Service, Grand Junction, Colorado. U.S. Fish and Wildlife Service. 2008. Birds of Conservation Concern 2008. United States Department of Interior, Fish and Wildlife Service, Division of Migratory Bird Management, Arlington, Virginia. 85 pp. Yamashita, M. 2020. Personal communications, 12/10/2020. CPW Area Wildlife Manager. Glenwood Springs, CO. Royal Mini Storage Wildlife Impact Report 19 Appendix A - CPW Habitat Definitions The following section defines the ungulate seasonal activity area definitions used by CDOW in their habitat mapping protocol. ELK HIGHWAY CROSSING: Those areas where elk movements traditionally cross roads, presenting potential conflicts between elk and motorists. MIGRATION CORRIDORS: A specific Mappable site through which large numbers of animals migrate and loss of which would change migration routes. OVERALL RANGE: The area which encompasses all known seasonal activity areas within the observed range of an elk population. PRODUCTION AREA: That part of the overall range of elk occupied by the females from May 15 to June 15 for calving. (Only known areas are Mapped and this does not include all production areas for the DAU). RESIDENT POPULATION: An area used year-round by a population of elk. Individuals could be found in any part of the area at any time of the year; the area cannot be subdivided into seasonal ranges. It is most likely included within the overall range of the larger population. SEVERE WINTER: That part of the range of a species where 90 percent of the individuals are located when the annual snowpack is at its maximum and/or temperatures are at a minimum in the two worst winters out of ten. The winter of 1983-84 is a good example of a severe winter. SUMMER CONCENTRATION: Those areas where elk concentrate from mid-June through mid-August. High quality forage, security, and lack of disturbance are characteristics of these areas to meet the high energy demands of lactation, calf rearing, antler growth, and general preparation for the rigors of fall and winter. SUMMER RANGE: That part of the range of a species where 90% of the individuals are located between spring green-up and the first heavy snowfall, or during a site specific period of summer as defined for each DAU. Summer range is not necessarily exclusive of winter range; in some areas winter range and summer range may overlap. WINTER CONCENTRATION: That part of the winter range of a species where densities are at least 200% greater than the surrounding winter range density during the same period used to define winter range in the average five winters out of ten. WINTER RANGE: That part of the overall range of a species where 90 percent of the individuals are located during the average five winters out of ten from the first heavy snowfall to spring green-up, or during a site specific period of winter as defined for each DAU. MULE DEER CONCENTRATION AREA: That part of the overall range where higher quality habitat supports significantly higher densities than surrounding areas. These areas are typically occupied year round and are not necessarily associated with a specific season. Includes rough break country, riparian areas, small drainages, and large areas of irrigated cropland. HIGHWAY CROSSING: Those areas where mule deer movements traditionally cross roads, presenting potential conflicts between mule deer and motorists. Royal Mini Storage Wildlife Impact Report 20 MIGRATION CORRIDORS: A specific Mappable site through which large numbers of animals migrate and loss of which would change migration routes. OVERALL RANGE: The area which encompasses all known seasonal activity areas within the observed range of a mule deer population. RESIDENT POPULATION: An area that provides year-round range for a population of mule deer. The resident mule deer use all of the area all year; it cannot be subdivided into seasonal ranges although it may be included within the overall range of the larger population. SEVERE WINTER: That part of the overall range where 90% of the individuals are located when the annual snowpack is at its maximum and/or temperatures are at a minimum in the two worst winters out of ten. SUMMER RANGE: That part of the overall range where 90% of the individuals are located between spring green-up and the first heavy snowfall. Summer range is not necessarily exclusive of winter range; in some areas winter range and summer range may overlap. WINTER CONCENTRATION: That part of the winter range where densities are at least 200% greater than the surrounding winter range density during the same period used to define winter range in the average five winters out of ten. WINTER RANGE: That part of the overall range where 90 percent of the individuals are located during the average five winters out of ten from the first heavy snowfall to spring green-up, or during a site specific period of winter as defined for each DAU. BLACK BEAR FALL CONCENTRATION: That portion of the overall range occupied from August 15 until September 30 for the purpose of ingesting large quantities of mast and berries to establish fat reserves for the winter hibernation period. HUMAN CONFLICT: That portion of the overall range where two or more confirmed black bear complaints per season were received which resulted in CDOW investigation, damage to persons or property (cabins, tents, vehicles, etc), and/or the removal of the problem bear(s). This does not include damage caused by bears to livestock. OVERALL RANGE: The area which encompasses all known seasonal activity areas within the observed range of a population of black bear. SUMMER CONCENTRATION: That portion of the overall range of the species where activity is greater than the surrounding overall range during that period from June 15 to August 15. ALTS/NSPS Land Title Survey ~-06(H:,.Q t:f~ 0 's ~ ! ~ ~ p H ., aooos •co•,,;;,,, 'c, i,I ~i;:ii!I"'~ ► ::1 :IS<> -.9 o· <»· ::"'-, <$~,i ol Bureau of Lo.n d Mo.nogeMent NOO'~"Jll"E •· , '\\.\~~ii~\■--·~cc.~,,,_· ;m1 m~~-~•,,~1mr: '~~~~1tt)~f 11~ ~,· ® .,~ ©0 ® 1~ ii •~~i • ~~2 •,-i Ii ti ,, "", ~~ .. ,, i'" :t i ~ ~ ~ !;! ~it 0 ; ~I g I' ~i § ~§ ~ ; !g ~ I. iH ;. ~ ~j ~ a" • a! ~ ¥; E ~j m ii •• "e ~~ s i ~ i r ~ ·~ . ' ' § !! {;; :;; ffl \~~~~--.:~&.~11~1 '~\\~~~,~~~~I .\ \ " f \ "\ ~ ~~:::::;;/iJ!":c I ,. '~"\;~ ~~·I '' \'t-~~~~~~.-- ''~-":~~ ~ ~ ~ ' "' "'~ ",ti~ •o~ ~'--\, ~-'-.\1 '-.' · f ,t{. \'-... \ /~ . :j::)i; I ''f!, , "' ~!'\ ~v; f •1~~1 .,,.s ••o •" ,,, •t"' .w~~.,, ~" .,.,·g,e ~-~·,,; .~~~,,'" lz ;w~-\ \ ~,., gg.~'[-; -g_~-:-,.....,, ~" s:(/) ;§~·00 ;:;< ~~ -§~~~"-51 Q~~~"'~ ~;r~i:gi ~ ~ ~"''' \ ~ . --' .J( I ;-'ooo aI, ~~ .~ !-i •o•n oj ,,a,•h •~g~o, '""'' "~ ~~~~! ~! ~ ~~ii: ~i ~ l::lc"',.,o Qill r- 2~CzA •e a •••o~ 2~ ~ !;;~::Ii -< ,;li_e; z ~~:~~ :1 ~ "':og~ ::15! 0 rlii.,iii ~~ rri ~::~ ij~ ~ ~~:~ t~ ~ ·~!; ~~ 5 1~~; !~ z <9s" S~ ~~~i ~-,~~· ,i ~~Vi ~~ ~il•I "s "~~2 ~ !~~~ ~ .-~ ~ ·~ '(Jl C ::0 < "" -< 0 ::0 cii n "' ~ ,; n ~ "' ,-·,j ~!ll !Ir !il r:: : :::::: ·::::: :::: : , . /4,i ,,·, :;~ ,., ~ •• ", ._,. ►0 ~, • eLhi g, ~,• , ·• 'i O ""o l:J I'/ _r. • ,-,o oa, , 0 zgo, > •-• o , •-••~ · c trJ //,,-,.,,.,1 "[a. ~ fi:S <> ..,_ "i Q.0 O c<'e,.O ::, c:r[:S:~li~ .,a:· g .. tuS:~'< ;:,::;i < , 1 ~ r / i ~: iH~! m : i n 1~ H ; mm um mi ~ ~ ,\// ,, 111 ~ 0 :0 1• .,, ~ • ;a.3 ~ aa ~ ,[,,.,~~ 1d a~ l•K a O er, \;~ ~! r nm ~H ; 1 H ! a ~ mm ;m; m; ~ ~ ~ \> ~ I ] 30 °0 0.. ~ ~ ~g ~ ~---· 3,.g :: :f 0 ,--,, 0 --l ~ --/~\ ;. ; I i., ., i & . s • • n, ,. . . . ► oz < z \. I . I ?-' ,,....., C/'J .,, -(/) '"O • m•• ~ •ffimp jj ! ~Fmi m.r; ~ 1~ ~ '...i o er, , -•,~•ah ,,ioa ~ o ~ z i:-- '" "' r n z ► -OC;')trlz §:i 2a >< ,-, -l -0 trJ V ·,,;:,,.~'",,,,,,,,,,,","m~~;H~m t!!; ~~;;i~[~un!~m tm 1~ 8 ~ ~ ~ r C >-3 I:"" o;i!o tri s';;,:, z (/) o:,, C o z ;i'; ~ I;;~< "' n trl 0 trl --< "'r ~S' -j?. i .... g:"";] '° ""' ,t '< ? ~ Cl) _-l ► -;,,~,l \ 'j 01 S oo ! ~ ;. !,..,. 1 1 I if Pi ~ -'/':11 ..... o, Rlc ho.rd Dever I 3:'.: 0:, , 3-~':;; r.. i < ('1 ~ "'"' Rec No 570056 ~ .,•.: I ) ' , \ \.' ~,, I ~ o•~. \ \ ( I ! 1 \ \ \ i~ l ~>!'f~ I /~ /: ~.~\ '!, 1100"0009"E74\02(M) I e! ~n~ oj ~ \\._:\~~~ \ / "' 'ti~~~// ==----') "->o ___________ _J < ,, •• , -,--,\----~~\/)\ I)?-~~~tS_Q?jJ?f'•cCc~ ~ : 1 / \f\\ >-\~ ¼0F ij~I~--= I 'i ~~(\ ~:,l~0 ~~J!(JJ,~/i;F----: I ) \ , '\,, G-~'.1/~~Y/.~:il})) / I ~ --I ii~ -:::~111\\~~{-l\~li i ;>~ \ -~ 3 \ -~\_~))~\~\~~\~i c~\\ ~\ \ ~~ I ~ \ \!ii'.'ti)if«t>~(~\/1~\l~l)/(((()01 :1 i :~;~~~~r1. '\ '\ f P'~~~~i1l ~j~~~; \\\1'~~~\~,1\1\I ((~ i ~ i ;f!i ~•Ii ')))~}~ ~~\\~;{\\\»'\\1\,,1\\,\s .il I '" ) \ ~~ ~ 1, >>.l~0 ,\ !g;~ ; ~•••\ \ i ,:"~" ~ I (('•~ ~ \ •a._, ! "* I ·~i ') \!; (~ / ~ ;i•' ,~; ~-r ( ;;j ; ! l;it!~~\~\\\~\i)~)1 1 t f ;:,-"~· :~i~ ~1;; ('ii ~~ r •t / ) !j ' r\ \ \~} \ 1 ii}\(\ \di\~ ~ ~ .,,. I~~•! f~ . ::'~~~ Q:;;~, ~ : a.. I \ \ P u ~ \ ~.::::::-~ ~,.;~ Ii! ;i .J ::'a:,s g:~,,~ ( 1 ( y~ J \\\/I\) ~~}it~~} ll~'::::c~ ,;. I[;: ,;: -'g~ I yP I I I Ii I I 1 / '1'1'/ 17f( L1_,,~~~~)'; 1;~ 1 • ~ ~ll I I Y-------7----y-----r--i i"!--7oI'§b ~ '!7•~~y~-~--,.-j--1 1 \--~ -........__ --..,, 1 1 T77+;/-;r7 ~ i _ Al'llcho.ux Lll'ilted (") .&9"90 I L 3 .H.~l .00 s ~ (•O ,Wll·im: Po.r tnershlpLLLP "" Rec . No. 569379 ~ ALTA/NSPS LAND TITLE SURVEY Stars to Stones Surveying DEVER SUBDIVISION EXEMPTION PARCELS A & B Profession al Land Surveying & Map p ing A PORTION OF SEC. 1, T.6 S ., R .90 W. OF THE 6th P.M. Stars2StonesSurveying@yahoo.com GARFIELD COUNTY, COLORADO 910.&1s.211sce11 Legal Water Supply Letter Karp Neu Hanlon www.mountainlawfirm.com Michael J. Sawyer Partner/Shareholder mjs@mountainlawfirm.com Direct: 970.928.2118 Office: 970.945.2261 Fax: 970.945.7336 *Direct Mail to Glenwood Springs Glenwood Springs ± Main Office 201 14th Street, Suite 200 P. O. Drawer 2030 Glenwood Springs, CO 81602 Aspen 323 W. Main Street Suite 301 Aspen, CO 81611 Montrose 1544 Oxbow Drive Suite 224 Montrose, CO 81402 April 20, 2022 Julie Pratte The Land Studio, Inc. Sent via email: landstudio2@comcast.net RE: Legal Water Supply for MMME WG property Dear Julie: I have been asked to provide a description of the legal water rights available to serve property owned by MMME WG LLC ³000(´ in West Glenwood Springs. My understanding is that the intended use of the MMME property is primarily for mini-storage which would include an office space with bathroom facilities. The mini-storage use will require water storage for fire suppression. The mini-storage uses are commercial in nature and are permanent water uses. Additionally, there will be two residences on the MMME property with customary indoor use and some limited outdoor irrigation. Finally, site preparation will require temporary construction water for dust suppression and soil compaction. At the time that MMME acquired the West Glenwood property, MMME acquired ³ &)6RIWKH1RWW1R'LWFKZDWHUULJKWV´Exhibit A. The Nott No. 1 Ditch water rights owned by the predecessor-in-interest were decreed in Civil Action No. 2140 with an appropriation date RI6HSWHPEHU DQGDQDGMXGLFDWLRQGDWHRI'HFHPEHU IRU³LUULJDWLRQSXUSRVHV´ DQGIRU³GRPHVWLFSXUSRVHV´ Exhibit B. The Nott Ditch water rights are senior to the Colorado River Compact. In Case No. W-3569 the Nott No. 1 Ditch water rights were changed to divert at the Dever Well Nos. 1, 2 and 3. Exhibit C. The Dever Well Nos. 1, 2 and 3 are permitted as well permits 84353-F, 84355-F, and 84354-F respectively. Exhibit D. Change in Owner Name/Mailing Address forms for each of the wells have been filed with the Division of Water Resources in the name of MMME WG, LLC. Exhibit E. The wells, operating under the Nott No. 1 Ditch water rights will provide the legal water supply for residential (domestic) and irrigation uses. 000(¶V share of the Nott No. 1 Ditch water rights is 0.22 cfs for domestic and 0.22 cfs irrigation purposes. 0.22 cfs is 82 gpm ± more than adequate legal water supply for two residential units and limited outdoor irrigation. For the permanent commercial and temporary construction water uses, MMME will obtain a West Divide Water Conservancy District contract. The MMME property is located in West 'LYLGH¶V³$UHD$´DQGFDQEHVHUYHGXQGHUWKH'LVWULFW¶VXPEUHOODDXJPHQWDWLRQSODQWater for Page 2 commercial uses will be from of Dever Wells 2 and 3. Temporary construction water will be from Dever Wells 1 and 3. Very truly yours, KARP NEU HANLON, P.C. Michael J. Sawyer MJS: Karp.Neu.Hanlon '.:.: AI ORNn''.i AT LAW - 925533 09/17/2019 09:05:20 AM Page 1 of 2 Jean Alberico, Garfield County, Colorado Rec Fee: $18.00 Doc Fee: $0.00 eRecorded WARRANTY DEED (Water Rights) THIS DEED is dated September J.k., 2019, and is made between Richard Thompson Dever, Meredith Richmond, and Robin Richmond, the "Grantors;· and MMME WG, LLC, a Colorado limited liability Company, the "Grantee," whose legal address is P.O. BoxllO, Glenwood Springs, CO 81602 of the County of Garfield and State of Colorado. WITNESS, that the Grantors, for and in consideration of the sum of TEN DOLLARS, the receipt and sufficiency of which is hereby acknowledged, hereby grants. bargains, sells, conveys and confirms unto the Grantee and the Grantee's heirs and assigns forever, all the property, together with any improvements thereon, located in the County ?f Garfield and State of Colorado, described as follows: 0.22 C.F.S. of the Nott No.1 Ditch water rights. TOGETHER with all and singular the hereditaments and appurtenances thereunto belonging, or in anywise appertaining, the reversions, remainders, rents, issues and profits thereof, and all the estate, right, title, interest, claim and demand whatsoever of the Grantors, either in law or equity, of, in and to the above bargained premises, with the hereditaments and appurtenances. TO HAVE AND TO HOLD the said premises above bargained and described, with the appurtenances, unto the Grantee and the Grantee's heirs and assigns forever. The Grantors, for itself and its successors and assigns, does covenant and agree that the Grantors shall and will WARRANT THE TITLE AND DEFEND the above dCSClibed premises, b111 not any aqjoining vacated slJ•eet or alley, if any, in the quiet and peaceable possession of the Grantee and the heirs and assigns of the Grantee. against all and every person or persons claiming the whole or any part thereot: by, through or under the Grantors except and subject to: 181 none; or O the following matters: STATE OF COLORADO COUNTY OF GARFIELD GRANTOR: /(u,,(w,) "rA~p,'11-w, l).~ Richard Thompson Dever The foregoing instrument was acknowledged before me this \ (,day of September 2019, by Richard Thompson Dever. Witness my hand and official seal. Notary Public LINDA GABOSSI NOTARY PUBUC STATE OF C0t.ORADO NOTARY to #19894007523 MyCommleelon Expli9s May 23, 2021 0.+M .P-+...-..ft 925533 09/17/2019 09:05:20 AM Page 2 of 2 Jean Alberico, Garfield County, Colorado Rec Fee: $18.00 Doc Fee: $0.00 eRecorded GRANTOR: f1.A£Le.c£%-~°dtlvf. 1rn!l_ STATE or COLORADO COUNTY OF GARFIELD Meredith Richmond The foregoing instrument was acknowledged before me this\{, day of September 2019, by Meredith Richmond. Witness my hand and official seal. Notary Public STA TB OF COLORADO COUNTY OF GARFIELD LINDA GABOSSI NOTARY·Puauc STATE OF COLORADO NOTARY 10 #1il894007523. My Commission Explr9I May 23, 2021 GRANTOR: Robin Richmond The foregoing instrument was acknowledged before me this\~ day of September 2019, by Robin Richmond. Witness my hand and official seal. Notary Public LINDA GABOSSI NOTAR'f PUBLIC STATE OF COLORADO NOT ARY 10 #19894007623 My Commission Expln,s May23, ~1 STATE OF COLO~ADO, COUJITY OF GJJ:.FIELD, ss. IN THE DISTRICT COURT •. In the matter of the application of The Hunn tieat and. Livestock Company, a corporation, for an ~d.jud.ication of its priority bf rights to the use of water for irrigation and domestic pur- poses, through the Third Enlargement and Extension of the Hott Ho. 1 Ditch, from Mitchell Creek, in Viater District Ho. 39, FHTDHTGS o's.ND DEC:REE. FILLO lN OISTRICT courn GAR~l[LO COlll'ITYJ;oL OR ADO Now on this 22nd a.ay of December, 11.D. 1920, the above enti•bled. matter coming on regularly for hearing before the aourt, and. the petitioner ap:ceari11g by J. s. Hunn, its Vice :?resident, and; by Charles ·::. Tciylor its attorne;y, ano. the Court having heard ithe testi- money offerea. on behalf of the petitioner, and. it appearing to the Court from the petition herein e.nd proofs offered to the Court, that the clairmmts as owners of the s<,1,id Nott No. 1 Ditch, and. the claim- an ts of enlargement •rights therein, on September 14th 1909, entered. into a written ag:i:-eertent with the petitioner whereby the pf;!ti tioner was given permission to enlarge said. ditch and to 'Gake water there- through from said creek for i1•, igation and domestic pu1·poses, said · agreement being made a part of the petition herein, and said peti- tion prayi11g that said agreement be made a part of the decree herein, and the Court bei.ng 11ov1 sufficiently advised in the premises; dotg find.: That the petitioner; The Eunn ]Jeat and. Livestock Company, is the owner of the s.1/2 H ,:r;.1/4, and Lot 1, of Section l, in Tovmship 6 S, R. 90 W, 6th :P.l'II,, oontainii:g 117 acres, more 01· less, that said said petitioner is also the claimant of the Third Enlargement and. E:z:tansion of the Nott Ho. l Ditch; said enlargement and exte:asion of saJ.d ditch is ·u;ie.a. for irrigation and a.owes tic purposes• and takes -1- its supply of water from lli'Gchell Creek, in water District No. 39; the head.gate of said. enlargement and extension is at the head.gate of said ditch whi<Jh is situated on the westerly bai-ik of said creek at a point whence the west 1/4 corner of section 34, Tp. 5 s. R, 89 Vi. 6th P.lv!. bears south, 15° 52' West 105.97 feet; the course of said q,;i.i;gl;+ 13,;na. said· enlargement thereof is in a southerly direction, and said entension thereof, in a westerly direction onto the land of the petitioner, of which land twenty-five acres is good irrigable land, under said , enlargement and extension of said ditch, and water has been beneficially applied therethrough on said land for irrigation; that the work of construction of sui d Third Enlargement and Extension oi .the nett lTo. 1 Ditch, was commenced on September 14th 1909, and the same was completed with all reasonable diligence to a v,ater carry- ing capacity of one cubic foot per second of t illle, in ad.di tion 1Xl the water carrying capacity of prior rights :th said ditch; that water in t~e QlllOunt of one-half of one cubic foot per second of time for domestic purposes has, by petitioner, been used through said enlarge• ment ancL extension of said ditch; that the capacity of saiclc enlarge- ment and extension of said ditch and the uses thereof made for irri- gation and domestic purposes is sufficient to entitle the same to an appropriation from l-/li tchell Creek of one-half of one cubic foot per second of t :iJne for irrigation am one-half of one cubic foot per second of time for domestic purposes, as of September 14th 1909; tlia t said Third Enlargemert and Extension d::f; the Nott JlTo. 1 :Di toh is entitled to Priority No. _________ , in said Vlater District No• 39 as o:f said date; that the said. written agreement between the petitioner and the claimants of the said Hott No. 1 Ditch and water rights therein, should be made a part hereof, and which agremment is in words and figures, as follows: " DITCH AGRE:Ellf!ElrT. This agreement made and enterec, into this fourteenth day of Septembe1·, 1909; by and between Bdwarlib T. Taylor and 'i/illiar:1 A. Evans, Ernest R,Wicke-- mi:j,n, ,clic e .:lrnichaux i;i.11d 1lhe Hunn Meat ancl. Livestock Company, a corporation, wi tnesseth; that vrherei;i.S : The saia. Taylor ana. Evans are jointly the owners of the w.1/2 of s.w.1/4, and s.E,1/4 of s.w.1/4, ano. s.w.1/4 of s.E.1/4, of sec. 34 To"cmship 5 S.R. 89 w. and also of Nott No. 1 and Nott No~ 2 ditches from Mitchell Creek, being Uos. 84 ana. 85 with priority l'Jos. 146 and 147, in the decree of the District Court for water district l\lo. 39, a11d the said Mrs.Alice .Arrlichaux is the ovmer of lots :Uos. 4,' 5 and 6, in Sec. 6, Township 6, S,R. 89. w., and is also owner with said Taylor and Evans of the so-called Burton ditch,being No, 36 A, and is sole owner of priority J\To. 48 A, in said decree of said court on said creek, e.na. the said YJickeman is the owner of the E.1/2 of the S,E,1/4 of Sec. 33, Township 5, S,Ic, 89 rr-t. and also of an enlargement. inter- est in the said Nott No. 1 ditch on the west side of said creek, sufficient for the irrigation of the portion of his said land lying thereunder; and the said Mrs. Alice Amichai1:x: is also the owner of' an enli,,,rgement interest in said ditch, suf:fi ci ent in amount to carry all or such pa.rt as she may desire of her said p1·iority No. 48 A, and the said Hunn Meat & Livestock Company is interested. in the S.1/2 of the U.E.1/4, of Sec. 1, Township 6, S. R. 89 W., and the saic1 company is cl.esirous of acg_uiring an enlargement interest in, and of enl/i;\rging the said ditch for the irrigation; of such pl;l.rt of said last described tract as may be irrigable, and. also of obtain- ing water for domestic purposes through saicl ditch; And the owners thereof are willing to permit the said company to raake said enlargement and i,,cquire an interest to that extent therein upon the following conditions, to-wit: FIRST; That the said Hunn ~ileat & ·Livestock company shall between now and. the commencement of the next irrigation season, ancl in such manner as may be of as little inconvenience and damage to the owners as is reason..; ably possible; enlarge the said cl.itch to whatever extent may be' necessary to make the same a three foot d.i tch on the bottom, with good substantial bank on the lower side, and. a practicable slope of the bank on the upper side, so that same will be a good practical ditch of saiil dimensions, and so that the same will carry at least one foot in depth of water flow with safety to the banks, and on as nearly as possible a uniform graile through- out from the head.gate to the lower portion of the said land of said Wicke- man. SECOND: That said. Company shall also put in at its own expense a good substantial a.nd practical head.gate two feet wide and of sufficient height and strength to regulate the flow of water in said ditch; and also replace the old flmne near the head.gate by a new one two feet wide and of sufficient height and strength to carry the water flow of said ditch, and shall al.so put in along the line of said ditch such number of dividing boxes as may be reasonably necessary a.nd convenient for each of the other co,-owners to use in dravling his OT her resp, ctive amount of water from said ditch, THIRD: It is :r:mtually agreed that after said. head.gate and flume and dividing. boxes are placed in said ditch and said enlargement is llllll,dEl and the work completed. in a practical ma.nner, that thereafter the e::s:pense off repairs and maintenance UjJOn said. headgate and flu:me,and the ani'mal cleaning out and repairing of said. ditch, shall be proportioned one-fourth each by the said paTties hereto; that is, the said Taylor and Evans jointly one• fourth, the said Wickeman one-fourth, the said Amichau:z: one-fourth, and the said Company one-fourth, from the headz;ate down to the lowest point thereon vihere all of said parties use said ditch, and thence on: down to the end in the proportion in which the said d.i tch is used. by sa;Ld remain- ing co-oimers as provided. by law. It is further understood. that, the divid- ing boxes l)laoed in said ditch, after same are so built and put in posi- tion in a JJracti cal way, shall thereafter be maintained at the joint ex- pense of the said oomJ?any one-half 2.na. the owners of each dividing box the other half. FOllRTH: It is further una.erstood that this agreement shecll not in any manner jeopardize or effect the J?riority rights of the said l,michaux or Taylor and Evans as adjudicated by the court~ that they shall be allowed to run their resJE cti ve decreed amounts o:i!' wate-.c throv.gh said ditch when- eve1· the Welter is available and is needed for the irrigation of, their larnis -3- thereunder; and that the said l;'.'icl:eman and said. Ocnnpany shall be permittea. to adjudicate their priority rights to the Iikcter of said creek through said. d.itch for their res1,ective lands thereuncler, ana. that tl.7.is agreement shall waive notice anil cell objections of the parties hereto to such adjudication; but it is unclerstooa. that the priority rights of ,che said Fickeuian are prior to the righ1;s of the said CompanJT• It is also understood. that the said. coIDJ)any sh,,11 c onstruqt a flume in said ditch at the point thereon irnrnediately above the cellar:belonging to said \'.'iokema.n and as at p1·esent located underlymng said ditch, in such a manner as to p-,:· event water from seeping through from said ditch into said. cellar. And said Company shc:cll 8.lso constn1ct, and. the owners of said. clitch shall thereafter nBintain a practical waste gate or spillway in said ditch at or near the flume near the head of said ditch,• sufficient to at all times carry off the excess water therein and pr event the over- flowing and breaking of said ditch Tuelow. It is furthe:c understood and agreed that the parties hereto shall not run an excessive amount of water in said ditch and shall eaaih exercise his best care to prevent breaks therein or damage to the ditch 0r to pro- perty along the line there of, ana. shall not polute said ditch or wa·ters therein or render the same unwholesome; ana. whenever any of the;owners are not d.esirous of using any of his share of the water of said ditch, if there is a scare ety of watel' in the creek, he shall cut cut his share at the head of the di toh and permit his sha:re of water to run down the creek; ana. if there is no scarcety of water in the creek, he shall take care of his share in such manner as to not tvJ1 it on his or her neighbor or damage the ditch or inconvenience them in any respect. It is further agreed awl. una.erstooa. that this agreement shall run with the so.id lana.s ana. operate as a perpetual right of way for said water rights E,nd be binding on the saia. parties, hereto, their heirs and assigns. In vdtnesr; whereof the parties here-t;o have hereunto se:t their hands and seals the a.ay ana. year as hereinabove given. Edward T. Taylor, Elise .P..r.o.ichaux Ernest H, WickS!Jllan vr. J. • Evans The Hunn Lfeat & Livestock co by J. S. Hunn, ]?'1"es"G. " IT IS TIIEREFORB COE3IDERED OR:C-Ei,ED ADJU1JGED AJllI) DEGREE]) .BY THE COURT: Tliat the Third L'nlargement ana. Extension of the No.tt No. 1 Ditch, be, a.nd the same is here1Jy given :Priority mm1ber --------- in said Water District lTo. 39, as of the saia. 14th day of September, li..D. 1909,' and that there lJe allowed to flow into said En:Largement and Extension of s~id. ditch, from ]:litchell Creek, for the use and benefit of i,hose lawfully enti'Gled thereto, for irrigation purposes, one-half of one cubic foot of wate1· iier second of time, and.for domestic purposes, one-half of one cubic foot of water :pet second of time, IT IEi :E'UR'l'EER ORDERED; ADJU1l.GED .:clT:O DECn:CED BY THE COURT: Tliat these findings ana .. this decree shall be subject to the same general condi ti ens and p:covisio:as as are conts,inea. in the general decree of thi.s Court made c:.no. entered on the 5th day of May A.D. 1888, in ancI for said. 17ater District No. 39, and shall also be subject to all prior decreed and vested rights, as provided by law, IT IS FURTHER ORDERED: That the said written agreement be- tween the petitioner and the claimants as owners and. of water rights in said Nott 1Jo. l Ditch, hel'einabove set forth, be, and is hereby rnao.e a part of this decree. IT IS FlTRTHElc ORDERED: That the J?eti ti oner herein pay the costs of this proceeding, Judge, -5- - FILED IN WATER COURT Division No. 5 IN THE DISTRICT COURT IN AND FOR WATER DIVISION NO. 5 JUN2 l 1979 . COLORADO STATE OF COLORADO Application No. W-3569 IN THE MATTER OF THE APPLICATION FOR WATER RIGHTS OF ) ) ) ) ) PAUL A. AMICHAUX IN THE COLORADO RIVER OR ITS TRIBUTARIES TRIBUTARY INVOLVED: MITCHELL IN GARFIELD COUNTY. CREEK) ) AMENDED RULING OF REFEREE The above entitled application was filed on December 2, 1977 and was referred to the undersigned as Water Referee tor Water Division No. 5, State or Colorado, by the Water Judge or said Court on the 13th day or January, 1978, and again, after stipulation and withdrawal of I opposition, on October 12, 1978, in accordance with Article 92 of Chapter 37, Colorado Revised Statutes 1973, known as The Water Rights Determination and Administration Act of 1969. And the undersigned Referee having made such investigations as are necessary to determine whether or not the statements in the application are true and having, become fully advised with respect to the subject matter of the application does hereby make the following determination and ruling as the Referee in this matter, to-wit: 1. The statements in the application are true. The statement of opposition has been withdrawn and the Referee has made no determination concerning the statement of opposition. 2. The names or the structures involved are: Nott No. l Ditch, Third Enlargement and Extension; Dever Well No. 1, Dever Well No. 2, Dever Well No. 3, Am1chaux Well No+ ~l, Amichaux Well No. 2, Amichaux Well No. 3, Am1chaux Well No. 4, Benzel Alternate Point No. l, and Benzel Alternate Point No. 2. 3. The names and address of the claimants: Willis E. Parkinson as representative of the Estate of Austin E. Dever, PO Box 698, Glenwood Spr1ngeJ, Colorado. Paul A. Am1chaux; PO Box 653, Glenwood Springs, Colorado. John Benzel and Richard Gilstrap, Po Box 158, Glenwood Springs, Colorado. JJ.; TM source of the water for the Nott ·No •. :.l Ditch, -Third , · Enla.rge•nt and Extension is Mitchell Creek, tributary to the Colorado River. · The source or the water tor the new points or diversion will be water tributary to the Colorado River below the confluence of Mitchell Creek and the Colorado River.· -1- W-3569 5. (a) The point or diversion or the Nott No. l Ditch, Third Enlargement and Extension, aa decreed, is located on the West•rly bank of Mitchell Creek at a point whence the West Quarter Corner or Section 34, T. 5 s., R. 89 w. of the 6th P.M. bears s. 15°52' w. 105.97 reet. (b) Dever Well No. 1 is located in the SWl/4 NEl/4 of Section 1, T. 6 s., R. 90 w. of the 6th P.M. at a point whence the South Quarter Comer ot Section 33, T. 5 s., R. 89 w. or the 6th P.M. bears N. 48°02'33" E. 2100.77 feet. (c) Dever Well No. 2 is located in the NEl/4 NEl/4 of Section 1, T. 6 s., R. 90 w. of the 6th P.M. at a point whence the South Quarter Corner of Section 33, T. 5 s., R. 89 w. of the 6th P.M. bears N. 22°38'48" E. 1297.33 feet. (d) Dever Well No. 3 1B located in the NEl/4 NEl/4 of Section 1, T. 6 s., R. 90 w. of the 6th P.M. at a point whence the South Quarter corner or Section 33, T. 5 s., R. 89 w. of the 6th P.M. bears N. 07°34'31" w. 1127.08 feet. (e) Am.ichaux Well Np. 1 is located in Lot 5, Section 6, T. 6 s., R. 89 w. or the 6th P.M. at a point 1200 feet South of the North line and 800 feet East or the West line or said Section 6. ( f) Am1chaux Well No. 2 is located in Lot 5, NWJ.t-.dflil/'1. or. Seetlon•':.6, T. 6 s., R. 89 w. of the 6th P .M. located 1000 feet from the North section line and 300 feet from the West section line. · · (g) Amichaux Well No. 3 1s located in Section 6, T. 6 S., R. 89 w. or the 6th P.M. whence a brass cap for the Southwest corner or Section 31', T. 5 s., R. 89 w. of the 6th P.M. bears N. 1,•51' E .• J01~: teat. (h) Amichaux Well No. 4 is located in Section 6, T. 6 s., R. 89 w. or the 6th P.M. whence a brass cap tor the Southwest corner or Section 34, T. 5 s., R. 89 w. of the 6th P.M. bears N. 4 3° 32' · E. 1209 feet . (1) Benzel Alternate Point No. l 1a looated at the Northeast corne:r or Lot 4, Sec. 6, T. 6 s., R. 89 w. of the 6th P.M. (J) Benzel Alternate Point No. 2 is located at a point 770 feet south ot the Northeast corner or Lot 4, Sec. 6, T. 6 s., R. 89 w .. or the 6th P .M. 6. On December 22, 1920, in Civil Action No. 2140, the Garfield County District Court awarded to the Nott No. 1 Ditch, Third Enlargement and Extension, Priority No. l77AAA, an absolute water right tor 1.0 cubic foot of water per second of time, 0.5 c.t.1. to be used for1rr1g.at1on pui-poses and 0.5 c.f.s. ··, ·. ,o :-be ;ulied tor,, -d~••Lcr~Plll'PO••••· rlfith appropriation --date of September 14, 1909. · 7. It has been previously determ:Lned that the ownership of this water right is divided among the a.pp1icants as follows: Willis E. Parkison as personal representative of the Estate of Austin E. Dever; 44%, which consists ot 0.22 o.r.s. for irrigation use and 0.22 e.r.s. for domestic use. Paul A. Amichaux; 34%, which consists or 0.17 c.r.s. for irrigation use and 0.17 c.f.s. for domestic use. John Benzel and Richard Gilstr•p; 22%, which consists of 0.11 c.r.s. for irrigation use and 0.11 c.r.s. for domestic use. -2- W-3569 8. On December 2, 1977, the applicants filed, in Water Court ror Water Division No. 5, an application for change of water right in which it is requested that the 1.0 cubic foot or water per aecond or time prev~ously awarded to the Nott No. 1 Ditch, Third Enlargement and Extension, under Priority No. 177AAA be transferred from the point or diversion of the Nott No. 1 Ditch, Third Enlargement and Extension, as decreed and as described in paragraph 5(a) above, to new points or diversion as follows: A. Applicant Willis E. Parkiaon as personal representative of the estate of Austin E. Dever will divert 44% of the water at the following alternate points of diversion: (1) Dever Well No. l, at the location as described 1n paragraph 5(b) above, (2) Dever Well No. 2, at the location as described in paragraph 5(c) above, (3) Dever Well No. 3, at the location as described in paragraph_ 5(d) above; B. Applicant Paul A. Amichaux will divert 34% of the water Right at the following alternate points of diversion: (1) Am1chaux Well No. l, at the location as described in par-graph 5(e) above, (2) Amichaux Well No. 2, at the location as described in paragraph 5(f) above, (3) Amichaux Well No. 3, at the location as describe~ 1n paragraph 5(g) above, (4) Amichaux Well No. 4, at the location as described in paragraph 5{h) above; c. Applicant John Benzel and Richard Gilstrap will dive~t 22% of the water right at the tollow1ng alternate points of diversion: (1) Benzel Alternate Point No.lat the location as described in -pa:r,apaph 5(1) above, (2) Benzel Alternate Point No. 2, at the location as described in paragraph 5(j) above, In support or this request it 1s stated that the use of the new points of diversion will eliminate the necessity or maintaining a ditch across other persons' property, and will permit a more efficient and econom19al use of the water right. 9. On February 28, 1978; a statement of opposition was filed by the City of Glenwood Springs, Colorado, and as a result,-on March 20, 1978, the application was re-referred by the Water Referee to the Water Judge for Water Division No. 5. 10. On October 11, 1978, the following Stipulation and Withdrawal or Opposition was filed in Water Court for Water Division No. 5: The Applicants, by their attorneys Delaney & Balcomb, and the Opponent, City or Glenwood Springs, Colorado, by its attorney, T. Peter Craven, Esq., hereby stipulate and ag~e as follows: -3- W-3569 A. Diversions by the applicants, pursuant to the Third Enlargement and Extension o~ the Nott No. l Ditch, Priority 177AAA,. at the points or diversion described in the Application tor Change or Water Right heretofore filed in the above captioned matter, will be or waters which are tributary to the Colorado River below its confluence with Mitchell Creek. B. The City or Glenwood Springs, is the owner and claimant of water rights on Mitchell Creek, and, as such, acknowledges that its rights will not be attected in any way as a result or the approval ot the changes of water rights requested by applicants herein 1n the "Application for Change or Water Right" heretofore tiled in the a~ove captioned matter. c. Diversions by the City pursuant to its Mitchell Creek Water Right& will neither enlarge no~ dtlllSn~sh the supply or water available to the applicants herein at the points of diversion requeeted in the Application for Change of Water Right heretotore filed herein. · · D. In consideration or the mutual covenants and agreements herein contained, the City or Glenwood Springs withdraws its Statement or Opposition heretofore filed in the abo.ve captioned matter and consents to the re-referral of the matter to the Referee for his informal deliberations and ruling. · As a result or the stipulation, and aLMotiort ore the, applicants, on October 12, 1978, the applications waa again referred to the Water Referee by the Water Judge for Water Division No. 5. The Referee does therefore conclude that the above entitled application should be granted and that new points of diversion for the Nott No. 1 Ditch, Third Enlargement and Extension, under Priority No. 177AAA, are hereby established at the locations, in the quantities, and operated in the m•anner as set forth in paragraph~ 7.,_. 8 above. No other vested water rights of others will be adversely affected by this change or water right. The Ruling of REferee dated December 27, 1978 is hereby cancelled. It is accordingly ORDERED that this ruling shall be filed with the Water Clerk and shall become errect~ve upon such filing, subject to Judicial review pursuant to Section 37-92-304, C.R.S. 1973. It is further ORDERED that a copy of this ruling shall be filed with the appropriate Division Engineer and the State Engineer. Done at the City or Glenwood Springs, Colorado this ~l lJ-day of _J_u_N_e _____ , 1979. No protest was filed in this matter. The foregoing ruling is confirmed ond approved, ond is made the Judgment and Decr~e o this court_,,Jv6Jc'! 1" "t Doted:. J; '13 7'. ""W. ~~ unps; BY THE REFEREE: eree Division No. 5 or Colorado fii/,w/1 -4- W-3569 No protest was riled in this matter, and accordingly the foregoing ruling is confirmed and approved, and is made the Judgment and Decree of this court; provided however, that the approval of this change or water right shall be subject to reconsideration by the Water Judge on the question of injury t9i;he vested rights of others during any hearing commencing in the""'iwo calendar years succeeding the year 1n which this decision is re dered. -5- COLORADO Division of Water Resources Department of Natural Resources ORIGINAL PERMIT APPLICANT(S) MEREDITH RICHMOND RICHARD T DEVER ROBIN RICHMOND WELL PERMIT NUMBER RECEIPT NUMBER APPROVED WELL LOCATION Water Division : 5 Water District: 39 Designated Basin : N/A Management District: N/A County: GARFIELD Parcel Name: N/A Physical Address: N/A 84353-F 3693741A AUTHORIZED AGENT SW 1/4 NE 1/4 Section 1 Township 6.0 S Range 90.0 W Sixth P.M. UTM COORDINATES (Meters, Zone: 13, NAD83) BALCOMB&. GREEN PC (GROSSCUP, SCOTT) Easting: 294950.0 Northing: PERMIT TO USE AN EXISTING WELL ISSUANCE OF THIS PERMIT DOES NOT CONFER A WATER RIGHT CONDITIONS OF APPROVAL 4381774.0 1) This well shall be used in such a way as to cause no material injury to existing water rights. The issuance of this permit does not ensure that no injury will occur to another vested water right or preclude another owner of a vested water right from seeking relief in a civil court action. 2) The construction of this well shall be in compliance with the Water Well Construction Rules 2 CCR 402-2, unless approval of a variance has been granted by the State Board of Examiners of Water Well Construction and Pump Installation Contractors in accordance with Rule 18. 3) Approved pursuant to CRS 37-90-137(2) and the decree granted for the Dever Well No. 1 in case no. W-184, Division 5 Water Court. The operation of this well is subject to the terms and conditions of said decree. 4) Approved as an alternate point of diversion i~ combination with the Dever Wells No. 2 and 3, for 0.44 cfs (0.22 cfs for domestic use and 0.22 cfs for irrigation) of the Nott No. 1 Ditch, Third Enlargement pursuant the decree granted in case no. W-3569, Division 5 Water Court. The operation of this well is subject to the terms and conditions of said decree. 5) Approved for the use of an existing well constructed under well permit no . 30751 , located on a 14.47 acre parcel described as Parcel B, Dever Subdivision Exemption, Garfield County. 6) The issuance of this permit hereby cancels permit no. 30751. 7) The use of ground water from this well is limited to domestic and irrigation purposes . 8) The pumping rate of this well while operating pursuant to the water right decreed in case no. W-184 shall not exceed 30 GPM (0.0669 CFS). While operating as an alternate point of diversion as decreed in case no. W-3569, the combined pumping rate of this well and Dever Wells Nos. 2 and 3 shall not exceed 0.44 CFS (0.22 CFS for domestic purposes and 0.22 CFS for irrigation). 9) The owner shall mark the well in a conspicuous location with well permit number(s), name of the aquifer, and court case number(s) as appropriate. The owner shall take necessary means and precautions to preserve these markings. 10) This well shall be located more than 600 feet from any existing well, completed in the same aquifer, that is not owned by the applicant. 11 ) This well shall be located not more than 200 feet from the location specified on this permit and not more than 200 feet from the location decreed for the Dever Well No. 1 in case nos. W-184 and W-3569 (decreed location is in the SW1 /4 of the NE1 /4, Section 1, Township 6S, Range 90W, of the 6th PM whence the S1 / 4 Cor of Sec 33, Twp. SS, Rng. 89 W bears N 48 02 33 E, 2100.77 ft). ~~-Date Issued: 5/29/2020 Issued By MEGAN SULLIVAN Expiration Date: N/ A Printed 05 -29-2020 For questions about this permit call 303.866.3581 or go to www.water.state.co.us Page 1 of 1 COLORADO Division of Water Resources DepArtment of Natural Resources ORIGINAL PERMIT APPLICANT<S) RICHARD T DEVER AUTHORIZED AGENT WELL PERMIT NUMBER RECEIPT NUMBER APPROVED WELL LOCATION Water Division: 5 Water District: 39 Designated Basin: N/A Management District: N/A County: GARFIELD Parcel Name: N/A Physical Address: N/A 84355-F 3693742 BALCOMB ft GREEN PC (GROSSCUP, SCOTT) SE 1/4 NE 1/4 Section 1 Township 6.0 S Range 90.0 W Sixth P.M. UTM COORDINATES (Meters, Zone :13, NAD83} Easting: 295166.0 Northing: PERMIT TO USE AN EXISTING WELL ISSUANCE OF THIS PERMIT DOES NOT CONFER A WATER RIGHT CONDITIONS OF APPROVAL 4381812.0 1) This well shall be used in such a way as to cause no material injury to existing water rights. The issuance of this permit does not ensure that no injury will occur to another vested water right or preclude another owner of a vested water right from seeking relief in a civil court action. 2) The construction of this well shall be in compliance with the Water Well Construction Rules 2 CCR 402-2, unless approval of a variance has been granted by the State Board of Examiners of Water Well Construction and Pump Installation Contractors in accordance with Rule 18. 3) Approved pursuant to CRS 37-90-137(2) and the decree granted for the Dever Well No. 2 in case no . W-184, Division 5 Water Court. The operation of this well is subject to the terms and conditions of said decree. 4) Approved as an alternate point of diversion in combination with the Dever Wells No. 1 and 3, for 0.44 cfs (0.22 cfs for domestic use and 0.22 cfs for irrigation) of the Nott No. 1 Ditch, Third Enlargement pursuant the decree granted in case no. W-3569, Division 5 Water Court. The operation of this well is subject to the terms and conditions of said decree. 5) Approved for the use of an existing well constructed under well permit no. 31320, located on a 13.57 acre parcel described as Lot 1, Dever Subdivision Exemption, Garfield County. 6) The issuance of this permit hereby cancels permit no. 31320. 7) The use of ground water from this well is limited to domestic and irrigation purposes. 8) The pumping rate of this well while operating pursuant to the water right decreed in case no. W-184 shall not exceed 30 GPM (0.0669 CFS). While operating as an alternate point of diversion as decreed in case no. W-3569, the combined pumping rate of this well and Dever Wells Nos. 1 and 3 shall not exceed 0.44 CFS (0.22 CFS for domestic purposes and 0.22 CFS for irrigation). 9) The owner shall mark the well in a conspicuous location with well permit number(s), name of the aquifer, and court case number(s) as appropriate. The owner shall take necessary means and precautions to preserve these markings. 10) This well shall be located more than 600 feet from any existing well, completed in the same aquifer, that is not owned by the applicant. 11) This well shall be located not more than 200 feet from the location specified on this permit and not more than 200 feet from the location decreed for the Dever Well No. 2 in case nos. W-184 and W-3569 ( decreed location is in the NE1 /4 of the NE1 / 4, Section 1, Township 6S, Range 90W, of the 6th PM whence the 51 / 4 Cor of Sec 33, Twp. 55, Rng. 89 W bears N 22 38 48 E, 1297.3 ft). Date Issued: 5/29/2020 Issued By MEGAN SULLIVAN Expiration Date: N/ A Printed 05-29-2020 For questions about this permit call 303.866.3581 or go to www.water.state.co.us Page 1 of 1 COLORADO Division of Water Resources Departme nt of Natura l Resources OR IGINAL PERMIT APPLICANT(S ) MEREDITH RICHMOND RICHARD T DEVER ROBIN RICHMOND WELL PERMIT NUMBER RECEIPT NUMBER APPROVED WELL LOC AT ION Water Division: 5 Wate r District: 39 Designated Basin : N/A Management District: N/A County : GARFIELD Parcel Name: N/A Physical Address : N/A 84354-F 3693741B AUTHORIZED AGENT NE 1/4 NE 1/4 Section 1 Township 6.0 S Range 90 .0 W Sixth P.M. UTM COORDINAT ES (Meters . Zone :13 . NAD83) BALCOMB &: GREEN PC (GROSSCUP , SCOTT ) Easting: 295358.0 Northing: PERMIT TO USE AN EXISTING WELL ISSUANCE OF THIS PERMIT DOES NOT CONFER A WATER RIGHT CONDITI ONS OF APPROVAL 4381928.0 1) This well shall be used in such a way as to cause no material injury to existing water rights . The issuance of this permit does not ensure that no injury will occur to another vested water right or preclude another owner of a vested water right from seeking relief in a civil court action. 3) The construction of this well shall be in compliance with the Water Well Construction Rules 2 CCR 402-2, unless approval of a variance has been granted by the State Board of Examiners of Water Well Construction and Pump Installation Contractors in accordance with Rule 18. 3) Approved pu rsuant to CRS 37-90-137(2) and the decree granted for the Dever Well No. 3 in case no. W-184, Division 5 Water Court. The o peration of this well is subject to the terms and conditions of said decree. 4 ) Approved as an alternate point of diversion in combination with the Dever Wells No . 1 and 2 , for 0.44 cfs (0 .22 cfs for domestic use and 0.22 cfs for irrigation) of the Nott No. 1 Ditch , Third Enlargement pursuant the decree granted in case no . W-3569 , Division 5 Water Court. The operation of this well is subject to the terms and conditions of said decree . 5) Approved for the use of an existing well constructed under well permit no. 31319, located on a 124.39 acre parcel described as Parcel B, Dever Subdivision Exemption, Garfield County. 6) The issuance of this permit hereby cancels permit no. 31319 . 7) The use of ground water from this well is limited to domestic and irrigation purposes. 8) ThThe pumping rate of this well while operating pursuant to the water right decreed in case no. W-184 shall not exceed 30 GPM (0.0669 CFS). While operating as an alternate point of diversion as decreed in case no. W-3569, the combined pumping rate of this well and Dever Wells Nos. 1 and 2 shall not e xceed 0.44 CFS (0.22 CFS for domestic purposes and 0.22 CFS for irrigation). 9) The owner shall mark the well in a conspicuous location with well permit number(s), name of the aquifer, and court case number(s) as appropriate. The owner shall take necessary means and precautions to preserve these markings. 10) This well shall be located more than 600 feet from any existing well, completed in the same aquifer, that is not owned by the applicant. 11) This well shall be located not more than 200 feet from the location specified on this permit and not more than 200 feet from the location decreed for the Dever Well No. 3 in case nos. W-184 and W-3569 (decreed location is in the NE1 /4 of the NE1 /4, Section 1, Township 65, Range 90W, of the 6th PM whence the 51 /4 Cor of Sec 33 , Twp. 55, Rng. 89 W bears N 07 34 31 E, 1127.08 ft). Date Issued: 5/29/2020 Issued By MEGAN SULLIVAN Expiration Date: NI A Printed 05-29-2020 For questions about this permit call 303.866.3581 or go to www .water.state.co.us Page 1 of 1 Landscape Plan xx xxxxx xxx xxxxx xxxx xxx xxxxxx x5774 5786 5760 5 7 40 5730 5 7 4 0 57625 7 6 4 5 7 8 2 5 7 9 2 5780 5784 57805 7 7 0 5 7 6 0 5 7 5 0 Notes: 1. Riprap or cobble, Provide a one-pound sample of material for review and approval. 2. Warranty plants and trees for one year after final acceptance. Replace dead or dying materials not in vigorous, thriving condition as soon as weather permits. 3. Determine locations of underground utilities and perform work in a manner which will avoid possible damage. 4. Plants shall be specimen quality, typical of their species or variety. 5. Plant trees and shrubs in pits 12" larger than tree ball, backfill with a mix of 2 parts topsoil and 1 part Nutri-Mulch. 6. Install "Weed Restrictor Fabric" between soil and crushed granite or cobble. 7. Amend soil in perennial and shrub planting beds with 3 cubic yards of weed free compost for every 1,000 s.f. of planting bed. 8. Boulders shall be angular in shape, 1/2 ton to 1 ton in size. 9. All plant materials to be irrigated with a drip irrigation system. All seed or sod areas to be irrigated with an underground system utilizing rotating sprinkler nozzels. Revegetation notes All areas disturbed during construction will be revegetated according to the following criteria. During construction, erosion which may pose a threat to surrounding properties or waterways will be contained through the use of temporary erosion control measures as deemed necessary. Revegetation of disturbed areas shall commence in the fall, prior to the first major snowfall, or early spring when site conditions allow. Erosion Control measures are aimed at controlling/confining sediment within or near the area of disturbance. The long term stability of these areas will depend on the establishment of appropriate ground cover vegetation. The primary goal of the revegetation effort is to protect water quality that will require a sturdy ground cover as soon as possible. All natural vegetation to remain shall be protected. Exposure of soil to erosion by removal or disturbance of vegetation shall be limited to the area required for immediate construction operations and for the shortest practical period of time. All disturbed areas shall be seeded or covered with rip-rap. Use Rivendell's native low grow Pitkin County seed mix. All topsoil shall be salvaged from disturbed areas, stockpiled and re-spread prior to revegetation. Topsoil should not be re-spread on areas of the site proposed for future building. Seed shall be drilled or otherwise mechanically incorporated into the soil ("farmed") or shall be hydraulically applied and followed by application of hydraulically applied mulch or straw. Straw mulch shall be secured in place with a hydraulically applied tackifier. Royal Mini Storage West GlenwoodGarfield County, Coloradodate: remarks: L1 20' Riprap or cobble buffer Reseed all distrubed areas See revegetation notes Low Grow Seed Mix (Pitkin County Seed Mix) Rate: 1 lb per 1,000 sq. ft. 25% Slender Wheatgrass 20% Mountain Brome 20% Western Wheatgrass 20% Secar Bluebunch 5% Thickspike Wheatgrass 5% Idaho Fescue 3% Green Needle 2% Indian Ricegrass LANDSCAPE PLANAPRIL 8, 2022The LAND Studio 365 River Bend Way Glenwood Springs, CO 81601 970.927.3690 landstudio2@com cast.net ~ ----------. . -----:-~ _:_:_:_~-:-:: --.. . -- '-1--i---Jltir r:;;;f,;J:;.;,;;}1;';{:';;;:~i;r:f::,; }ij!]~;;t;;·;):~;• /c' /•; <S · ,'C •·. Lighting Plan )LOHQDPH & ?8VHUV?PDUJDUHWFDOODQ?'HVNWRS?*RXOG0LQL6WRUDJH/D\RXW$$*,The Lighting Analysis, ezLayout, Energy Analysis and/or Visual Simulation ("Lighting Design") provided byRAB Lighting Inc. ("RAB") represents an anticipated prediction of lighting system performance based upon designparameters and information supplied by others. These design parameters and information provided by others havenot been field verified by RAB and therefore actual measured results may vary from the actual field conditions.RAB recommends that design parameters and other information be field verified to reduce variation.RAB neither warranties, either implied or stated with regard to actual measured light levels or energy consumptionlevels as compared to those illustrated by the Lighting Design. RAB neither warranties, either implied or stated, norrepresents the appropriateness, completeness or suitability of the Lighting Design intent as compliant with anyapplicable regulatory code requirements with the exception of those specifically stated on drawings created andsubmitted by RAB. The Lighting design is issued, in whole or in part, as advisory documents for informational purposesand is not intended for construction nor as being part of a project's construction documentation package.Scale: as notedDate:2/14/2022Filename: Gould Mini Storage Layout 00804287A.AGIDrawn By:Margaret KoenigPrepared For:Electrical Lines10600 E 54th Ave DrUnit D & EDenver, CO 80239Tel: 303-722-5721Glenwood Springs, COLighting LayoutVersion AJob Name:Gould Mini StorageCASE # 00804287PROJECT # 161165Scale: 1 inch= 20 Ft.1BB23BB4B5B67B8BB9B1011BB12B1317B18BB19B2021BB2223B24BB25B2627BB28B2930B34BB35B37B3839BB40B4142BB43B44B4546B47BB4849BB51B53B5960BB6162BB63B64B65B67B6869BB70B7374BB75B8485B86BB8789BB9091B92BB93B9495B96BB9798B105BB106B107109B110BB111B113114B115B116BB119120BB1219.7 5.6 0.8 0.8 3.7 17.4 1.9 0.4 1.0 11.81.6 1.4 2.8 7.1 3.0 3.0 1.5 3.4 3.1 5.0 3.5 0.4 0.3 0.2 0.2 2.9 14.2 2.4 0.8 0.9 5.910.11.30.82.114.43.50.71.06.110.51.20.72.215.13.30.20.10.10.45.911.21.30.62.015.93.60.60.96.211.61.20.62.016.83.40.30.56.111.90.4 1.1 13.6 5.6 0.8 0.4 0.2 3.8 0.7 0.4 1.4 1.8 2.4 8.7 2.9 1.6 1.9 3.6 7.9 2.0 2.0 1.5 4.6 6.5 2.2 2.0 2.2 7.5 3.1 2.3 1.2 1.1 0.5 0.3 0.8 1.7 2.3 3.3 6.4 2.0 2.5 1.7 4.0 5.4 2.6 2.5 2.1 5.9 3.0 2.9 1.5 1.1 0.8 2.1 2.610.3 1.0 1.0 6.611.3 2.0 1.1 6.62.4 0.4 0.2 11.3 2.0 0.3 0.21.5 0.5 1.1 7.65.7 1.6 1.1 7.75.6 1.5 0.1 0.12.2 0.5 0.5 1.01.0 0.6 0.6 1.00.9 0.6 0.10.00.7 0.5 2.5 20.2 2.18.4 0.7 0.9 4.47.2 1.7 1.0 4.57.1 1.7 0.10.03.2 4.0 2.4 5.0 2.3 2.4 2.0 6.8 5.5 1.4 1.1 0.4 2.1 0.4 1.2 10.3 0.4 0.8 7.8 10.1 0.9 0.4 2.0 19.6 3.0 0.5 0.5 4.4 15.7 1.3 0.4 1.5 17.1 3.8 0.5 0.3 9.1 1.8 1.2 10.3 0.3 0.3 1.7 18.8 2.8 0.4 0.5 4.0 15.2 1.2 0.3 1.3 15.79.1 1.8 0.10.06.1 12.7 1.1 0.5 2.0 15.3 3.7 0.9 1.0 5.3 9.2 1.6 0.8 0.3 0.5 1.9 3.7 3.0 3.2 3.3 2.3 3.9 2.3 4.1 2.4 3.4 2.8 2.8 4.2 2.5 3.6 2.0 4.4 2.9 3.1 2.4 1.0 0.5 0.6 1.4 1.5 3.12.35.12.62.72.43.15.22.32.82.05.53.22.51.91.00.40.10.012.1 4.3 0.4 0.7 3.3 13.6 5.8 0.6 0.5 3.2 19.3 2.0 0.4 1.1 11.9 6.6 0.7 0.5 3.4 18.92.0 0.5 1.1 11.86.6 1.4 0.6 0.8 2.7 3.2 18.12.1 0.5 1.1 11.16.7 0.8 0.6 3.4 17.4 2.2 0.6 1.2 10.9 6.5 1.4 0.5 0.10.06.0 3.2 0.4 1.3 12.911.5 1.9 1.4 12.911.5 1.8 0.10.01.9 1.3 0.3 0.8 2.75.3 1.5 0.9 2.85.2 1.4 0.10.017.5 3.3 0.3 1.0 4.42.3 1.0 1.1 4.52.3 1.0 0.10.02.1 2.0 6.6 6.2 1.3 1.2 3.0 14.0 2.7 0.7 0.5 3.6 1.7 0.2 1.3 10.914.7 1.9 1.3 10.914.8 2.0 0.2 0.111.9 5.5 1.1 0.9 3.7 11.0 2.2 1.6 1.6 6.4 3.8 0.5 0.2 0.1 0.6 2.2 2.0 2.6 8.4 2.6 1.6 1.9 4.3 7.7 1.7 1.8 1.9 8.1 4.2 1.6 1.7 4.0 8.7 1.9 1.6 0.8 3.1 1.1 0.5 1.4 1.2 1.64.58.91.71.51.89.14.51.41.44.19.91.81.30.73.11.51.20.70.20.0 0.00.2 3.2 14.7 2.3 0.7 1.0 7.1 8.8 1.2 0.8 2.5 14.5 3.1 0.9 1.1 6.9 8.5 1.3 0.9 2.5 13.92.8 0.3 0.2 0.1 0.5 6.6 8.4 1.4 1.0 2.5 13.13.2 1.1 1.2 6.5 8.2 1.4 1.1 2.5 12.52.8 0.4 1.7 11.43.51111111111111111111111110.50.50.50.50.50.50.5333333 3333333333333333333333333333333333335555555555555555555555555-------;ti --.--~-• • • ------• • • • • • .-.---. • • • • • • • • -•------ala • • • .-I ~' -t I ----------• • • • • • .-•---. • • • • __ / . -• • • 7 I I I I I 1· • I' I 1. I • • • • • • I • • • • • :. I I I I I• I • • • . , I I I I /. • • • • • • • • • • • __. 1 • • • -. ---• I • • • • •~-• • • • • • • • • • • • • • • • • • • • • • • • • • -----• • ' I ---=----=---~ C ---=-~ • • • • • • • • • • • • • • • • • • • • • • • • • -~-, • • • • ------• •' ---=--=-=-= • • • • • • • • • • • • • • • • • • • • • • • • • • • • ., I • • • • • ---=--~ • • • • • • • • • • • • • • • • • • • • • • • • • • • •' • • • ' I I I • • • • • .----. • • • • • • ,---=---=---------=-~ • • • • • • _. • • • / ' ' i ' ' I ~=------' = c---=-~ -• • • • • • • • • • • • • • • • • • • • • • • • • • • ---.--. • • • • • • • • • • • • • • • • • • • , . • • • )LOHQDPH & ?8VHUV?PDUJDUHWFDOODQ?'HVNWRS?*RXOG0LQL6WRUDJH/D\RXW$$*,The Lighting Analysis, ezLayout, Energy Analysis and/or Visual Simulation ("Lighting Design") provided byRAB Lighting Inc. ("RAB") represents an anticipated prediction of lighting system performance based upon designparameters and information supplied by others. These design parameters and information provided by others havenot been field verified by RAB and therefore actual measured results may vary from the actual field conditions.RAB recommends that design parameters and other information be field verified to reduce variation.RAB neither warranties, either implied or stated with regard to actual measured light levels or energy consumptionlevels as compared to those illustrated by the Lighting Design. RAB neither warranties, either implied or stated, norrepresents the appropriateness, completeness or suitability of the Lighting Design intent as compliant with anyapplicable regulatory code requirements with the exception of those specifically stated on drawings created andsubmitted by RAB. The Lighting design is issued, in whole or in part, as advisory documents for informational purposesand is not intended for construction nor as being part of a project's construction documentation package.Scale: as notedDate:2/14/2022Filename: Gould Mini Storage Layout 00804287A.AGIDrawn By:Margaret Koenig10600 E 54th Ave DrUnit D & EDenver, CO 80239Tel: 303-722-5721Prepared For:Electrical LinesJob Name:Gould Mini StorageGlenwood Springs, COLighting LayoutVersion ACASE # 00804287PROJECT # 161165Scale: 1 inch= 20 Ft.B9B1011BB12B13B1415BA1623BB26B28B2930B31B32B33B36BB3739B4BB4849BB5152BB5354B55B56B57BB58B6566BB6771BB72B7374BB75B76B77B7879BB8081BB8283BB84B8895B96BB9798B99B100BB101B103B104108B112B11B116BB117B118B119120BB121B122123B124B125B126B127BB128A134B1301.5 8.7 6.2 0.5 0.8 9.5 7.8 0.8 0.4 1.4 15.90.6 1.5 1.2 0.3 0.8 2.7 2.3 2.3 4.0 2.1 5.1 3.2 2.4 5.2 8.3 1.2 0.8 2.3 11.5 4.2 0.6 0.9 5.1 14.0 1.2 0.1 0.2 3.4 16.30.2 0.2 0.2 1.7 7.2 0.4 3.3 18.3 1.8 0.5 1.2 11.0 6.3 1.1 0.6 3.4 11.7 2.9 1.1 1.0 6.55.52.81.10.30.63.15.83.01.83.49.42.01.21.59.75.60.80.83.717.41.9 0.4 1.0 11.80.1 0.2 2.0 9.20.5 5.6 1.0 1.8 7.1 1.3 11.1 5.9 0.9 0.9 2.3 11.8 3.4 1.6 1.4 2.8 7.1 3.0 3.0 1.5 3.4 3.1 5.0 3.5 0.4 0.3 0.2 0.2 2.9 14.2 2.4 0.8 0.9 5.910.1 0.2 1.4 2.88.3 1.1 2.0 9.60.4 1.1 13.6 5.6 0.8 0.4 0.2 3.8 0.7 0.4 1.4 1.8 2.4 8.7 2.9 1.610.1 0.2 3.1 18.71.1 0.5 0.7 1.010.3 1.0 1.0 6.60.1 0.3 1.6 4.13.4 0.7 2.1 4.41.5 0.5 1.1 7.60.1 1.4 3.4 2.6 6.5 3.1 1.7 1.7 4.5 9.8 1.7 1.0 2.1 13.9 3.6 0.7 0.6 3.8 17.5 1.6 0.3 8.2 0.8 3.5 16.02.2 0.5 0.5 1.02.5 19.7 2.5 0.6 1.0 8.2 7.1 1.3 1.1 2.9 10.5 2.8 2.0 1.7 4.8 4.2 2.4 3.8 2.3 3.0 1.11.50.51.12.21.54.411.21.70.81.411.95.60.70.52.520.22.18.40.70.94.47.1 0.7 0.5 3.0 18.8 2.1 2.3 0.6 1.8 7.1 8.7 1.6 1.4 1.9 8.4 3.6 2.5 2.0 3.2 4.0 2.4 5.0 2.3 2.4 2.0 6.8 5.5 1.4 1.1 0.4 2.1 0.4 1.2 10.3 0.4 0.8 7.8 10.1 0.9018.0 5.7 0.8 6.00.6 6.1 12.7 1.1 0.5 2.0 15.3 3.7 0.9 1.0 5.3 9.2 1.6 0.8 0.3 0.5 1.9 3.7 3.0 3.2 3.3 2.333.0 2.4 0.8 2.712.1 4.3 0.4 0.7 3.3 13.6 5.8 0.6 0.5 3.2117.8 4.1 0.8 3.06.0 3.2 0.4 1.3 12.93.5 2.0 0.8 9.01.9 1.3 0.3 0.8 2.70.2 0.2 0.4 1.8 0.6 1.6 13.3 5.1 0.6 0.5 2.6 19.917.5 3.3 0.3 1.0 4.40.00.1 1.4 7.7 3.5 2.6 1.9 2.3 4.0 2.9 5.3 2.0 2.1 2.0 6.6 6.2 1.3 1.2 3.0 14.0 2.7 0.7 0.5 3.6 1.7 0.2 1.3 10.90.4 3.7 17.4 1.8 0.5 1.3 11.9 5.5 1.1 0.9 3.7 11.0 2.2 1.6 1.6 6.4 3.8 0.5 0.2 0.1 0.6 2.2 2.0 2.6 8.4 2.6 1.610.20.0 0.00.2 3.2 14.7 2.3 0.7 1.0 7.183.8 5.8 5.1 3.72.5 2.9 2.8 2.4.91.1 1.2 1.2 1.1.50.40.30.4 0.4.3.90.9.21.2 1.61.3 2.1 3.62.2 3.5 7.02.7 3.5 3.72.2 2.2 1.7 0.51.1 0.9 0.50.4111111111111111111110.50.50.50.50.50.50.5333333333333333333333333333333333555555555555555555555113Cc • • /. • • • • • • • • • ---;;l---~/--• • • I •1 I // -;/4-=r • • • • • • • • • I I I I 1• I I -;,-. k,,,/, I / ,.)z", i '~";'" 7 ', \ /( \\ 'i },,,-_\ •. ),._.,:---• • • • • • • • • • • I I I ' • • • • • ----__ .._ ---• • • • • • • -----------• • • _ _,..--/ ---• • • --------.--,,. ------------7la • • • • • • • • • --------a. . ---· I ~I I • • .-• I --~-~_;:,~-,':_,,~----t-t--~~_,,..--~_:----• • • • • ,. • • __ --jl ' \,. I I • • 7r • • I I I I I I I I • I • • • • • • • • • • I I I I I 1·1 I /.I • • • • • • • • • • • • • • • • ----=--~ .~ I I I I "I ,\ • • I I I I I • --·-• • • • u . ,.. • • I,.{ ""-e-----~--,-I I I I L • • • • • • • • • • • • • • • • • • • • • . ( • --•--• • • • • • • • • • • • -------..,...-,c --r-1~ ~ ~ -~ ~ ~ ~ -1~ ~ ~ -~ ~ ~ -~I -----------= --------,,:, • • • • • • • • -----a:;:: • ·--,,-.._ -• • • ,E._-----\~ 1~/ I • • • • .. • • • • • • • • I I -------. • I I I I • • • • • • ~-----=---~ ~ -~------i I • • • \• • • • • ' •\ • • • • // ,, " ' / ./ ( . \ . I \ / • .J ' l • • • .I • • • -" • • • ' • • • • • • ,-•--. . . ----------"·~-• • • • • ---. • )LOHQDPH & ?8VHUV?PDUJDUHWFDOODQ?'HVNWRS?*RXOG0LQL6WRUDJH/D\RXW$$*,The Lighting Analysis, ezLayout, Energy Analysis and/or Visual Simulation ("Lighting Design") provided byRAB Lighting Inc. ("RAB") represents an anticipated prediction of lighting system performance based upon designparameters and information supplied by others. These design parameters and information provided by others havenot been field verified by RAB and therefore actual measured results may vary from the actual field conditions.RAB recommends that design parameters and other information be field verified to reduce variation.RAB neither warranties, either implied or stated with regard to actual measured light levels or energy consumptionlevels as compared to those illustrated by the Lighting Design. RAB neither warranties, either implied or stated, norrepresents the appropriateness, completeness or suitability of the Lighting Design intent as compliant with anyapplicable regulatory code requirements with the exception of those specifically stated on drawings created andsubmitted by RAB. The Lighting design is issued, in whole or in part, as advisory documents for informational purposesand is not intended for construction nor as being part of a project's construction documentation package.Scale: as notedDate:2/14/2022Filename: Gould Mini Storage Layout 00804287A.AGIDrawn By:Margaret KoenigPrepared For:Electrical Lines10600 E 54th Ave DrUnit D & EDenver, CO 80239Tel: 303-722-5721Lighting LayoutVersion AJob Name:Gould Mini StorageGlenwood Springs, COCASE # 00804287PROJECT # 161165Scale: 1 inch= 20 Ft.A1666B71BB7281BB8283BB88A102112BB117B118126B127BB128129BB131B132133BA134B135B136137BB138B139141B142B144BB146B148149BA150B152154B6157BB160161B163BB165B166B167B68B1691A50A140B1301.5 8.7 6.2 0.5 0.8 9.5 7.8 0.8 0.4 1.4 15.90.6 1.5 1.2 0.3 0.8 2.7 2.3 2.3 4.0 2.1 5.1 3.2 2.4 5.2 8.3 1.200.2 0.2 0.2 1.7 7.2 0.4 3.3 18.3 1.8 0.5 1.2 11.0 6.3 1.1 0.630.1 0.2 2.0 9.20.1 0.2 1.4 2.80.1 0.2 3.1 18.70.1 0.3 1.6 4.10.1 1.4 3.4 2.6 6.5 3.1 1.7 1.7 4.5 9.8 1.7 1.0 2.1 13.932.5 19.7 2.5 0.6 1.0 8.2 7.1 1.3 1.1 2.9 10.5 2.8 2.011.1 2.4 1.6 0.93.6 2.3 1.15.6 2.95.5 3.03.7 2.63.8 5.8 5.1 3.72.4 1.9 1.4 1.3 2.5 2.9 2.8 2.41.8 1.6 1.0 0.8 0.9 1.1 1.2 1.2 1.11.3 2.1 1.6 0.9 0.6 0.5 0.40.30.4 0.42.2 3.2 2.24.0 4.3 2.64.8 4.2 2.53.0 3.0 2.01.9 1.9 1.31.3 1.11.2 1.61.3 2.3 2.92.5 4.52.4 3.6 5.62.6 3.5 2.31.9 1.9 0.91.2 1.2 1.61.3 2.1 3.62.2 3.5 7.02.7 3.5 3.72.2 2.2 1.7 0.51.1 0.9 0.50.440.2 0.10.0 0.00.191.0 0.1 0.1 0.2 0.8 0.7 0.3 0.3 0.2 0.12.5 0.5 0.9 1.2 6.2 7.0 0.9 2.9 3.3 0.7 1.0 1.2 0.5 0.3 0.49.55.0 0.8 6.17.1 10.8 1.0 4.2 10.8 1.3 2.1 5.7 1.6 0.8 1.9 1.061.8 0.8 4.018.2 1.8 1.9 14.6 3.2 1.8 8.6 2.5 1.1 3.0 1.3 0.6 1.001.9 1.0 3.62.0 18.9 2.9 1.5 10.4 4.0 0.7 0.8 1.5 2.7 3.5 3.6 2.721.7 1.4 12.64.9 1.8 0.6 1.2 2.4 5.2 6.2 3.920.5 0.7 2.3 0.9 4.9 15.5 1.212.9 2.3 0.2 0.270.1 0.4 4.1 7.6 2.9 3.3 1.4 2.1 2.6 11.7 3.6 0.6 0.7 4.52.1 1.0 0.1 0.10.9 0.4 1.9 14.5 4.0 1.5 1.2 3.7 4.4 3.9 5.5 1.3 1.3 3.0 16.4 2.8 0.49.3 1.1 0.10.010.8 1.1 0.6 2.3 11.8 3.7 2.4 1.4 2.6 2.8 6.3 6.7 1.2 3.5 18.1 6.8 0.8 0.2 0.10.7 9.3 8.5 1.3 0.9 2.5 9.3 4.6 1.4 0.6 1.6 1.21.8 0.3 0.8 9.0 6.61110.50.50.533333335555110.533335111111110.50.50.50.533333333333355555• • • • • • I • .1 I • :-• : ,.\, • I I I I • • • • 0-I I ,, I I I I • • 1_ • • • • • • • • -0 • • • ----• • • • • • • • • • • • • • • • ----. • • • / • • . • • • _.!!;'-7 • I I I I I I • , ____ _ • • • • • •'i I I I I • I I • • • • • • • ,• I I I • • I I I ' I I I I I I I I • I ' I I ----I I . ' I • • • • • • I I L-------I I I I • • • • • • • • • • '• . I 1. I I • • I I I I~ ~ I I • I I • I .1 I I • • • • • • • • • I I I o I • • • • • • • • • • • • • • • • • • ' I I I L • I I I I • • / . • • • • • • • • 1,1 1\1 1\I iJ • • • • • • .1 ,' I I -l-I I I I l . I • ·1 I ~~ I ' • • • 7 • • • • I • •. • • • • • • I • • • • • • • ---,I • I I J I • ·'"'"" ,->"''" • ·,.-;, • ------a, • • • • • • • • • • • • • ~. • • • • • • • • • • ---------, ''~-,,..,_,¾, ",, ",' ",, "" ",, ' " ":;_>~ ----===---==-" E ~ 0 0 ~ z rn C .£!l E "' g, > £ :0 i5 ~ z w ::> C t 0 0 3: 0 Q "" 'O N ::> " .., R 00 00 00 )LOHQDPH & ?8VHUV?PDUJDUHWFDOODQ?'HVNWRS?*RXOG0LQL6WRUDJH/D\RXW$$*,The Lighting Analysis, ezLayout, Energy Analysis and/or Visual Simulation ("Lighting Design") provided byRAB Lighting Inc. ("RAB") represents an anticipated prediction of lighting system performance based upon designparameters and information supplied by others. These design parameters and information provided by others havenot been field verified by RAB and therefore actual measured results may vary from the actual field conditions.RAB recommends that design parameters and other information be field verified to reduce variation.RAB neither warranties, either implied or stated with regard to actual measured light levels or energy consumptionlevels as compared to those illustrated by the Lighting Design. RAB neither warranties, either implied or stated, norrepresents the appropriateness, completeness or suitability of the Lighting Design intent as compliant with anyapplicable regulatory code requirements with the exception of those specifically stated on drawings created andsubmitted by RAB. The Lighting design is issued, in whole or in part, as advisory documents for informational purposesand is not intended for construction nor as being part of a project's construction documentation package.Scale: as notedDate:2/14/2022Filename: Gould Mini Storage Layout 00804287A.AGIDrawn By:Margaret Koenig10600 E 54th Ave DrUnit D & EDenver, CO 80239Tel: 303-722-5721Prepared For:Electrical LinesJob Name:Gould Mini StorageGlenwood Springs, COLighting LayoutVersion ACASE # 00804287PROJECT # 161165Scale: 1 inch= 20 Ft.133BB135137B141B142B143B144B145BB146147BB148B151B152B153B155B156158B159BB1161B162B163BB164B165B166B167B168B169170BB171B172B173174B175B176B177BB178179AA1801.3 0.73.1 1.6 0.8 0.4 0.3 0.2 0.1 0.11.4 1.1 0.7 1.0 2.2 1.1 0.5 0.7 0.4 0.2 0.2 0.1 0.10.2 0.3 1.4 3.8 15.6 3.1 1.4 8.8 3.4 0.8 3.0 1.9 0.5 0.9 0.8 0.3 0.3 0.3 0.20.1 0.3 4.0 20.21.0 13.9 5.2 0.9 6.5 7.3 0.9 2.8 3.9 0.9 1.2 1.4 0.5 0.5 0.4 0.2 0.10.0 0.00.10.00.1 0.4 2.0 2.75.2 13.0 1.3 5.4 9.9 1.2 3.8 5.9 1.0 0.1 0.1 0.2 0.8 0.7 0.3 0.3 0.2 0.10.00.1 0.6 5.02.5 0.5 0.9 1.2 6.2 7.0 0.9 2.9 3.3 0.7 1.0 1.2 0.5 0.3 0.40.2 0.3 0.8 7.219.5 5.0 0.8 6.17.1 10.8 1.0 4.2 10.8 1.3 2.1 5.7 1.6 0.8 1.9 1.01.6 3.7 1.4 0.9 0.8 1.0 1.7 14.1 4.5 0.52.6 1.8 0.8 4.018.2 1.8 1.9 14.6 3.2 1.882.8 19.2 1.9 0.4 4.1 9.5 1.9 2.7 2.5 2.9 1.7 4.1 10.7 1.9 0.7 2.1 19.48.0 1.9 1.0 3.60.3 1.7 16.2 4.0 1.0 1.4 4.5 5.9 2.2 4.8 2.4 1.7 1.4 6.7 9.3 1.1 0.3 8.2 1.7 1.4 12.61.0 0.5 2.2 13.4 3.5 1.6 2.0 3.5 3.3 1.2 0.5 0.7 2.3 0.9 4.9 15.5 1.28.7 9.9 0.7 0.1 0.4 4.1 7.6 2.9 3.3 1.4 2.1 2.6 11.7 3.6 0.6 0.7 4.50.9 0.4 1.9 14.5 4.0 1.5 1.2 3.7 4.4 3.9 5.5 1.3 1.3 3.0 16.4 2.8010.8 1.1 0.6 2.3 11.8 3.7 2.4 1.420.791.5 1.92.7 3.2 3.1 2.6 1.72.1 5.4 6.1 3.7 2.2 1.41.11.3 1.61.9 1.3 1.3 1.9 2.6 3.0 2.8 2.22.0 3.9 6.0 4.92.311111111111110.50.50.50.50.50.50.533333333333333333555555335. -• • • • • • • • • • \ • I \,II I-I I / /.,/~ ' ~--------~:~><::._~~.-~ ---l • • • • • • • I I ·1 • • . \ "1 I '1 I I I '1 I . --~ I I I .--.i1 I ' I '',,,, \l-----,Ji . .,, . __ .....-------------~'c __ _ _:,<e • '!-__ ,--. • • --------• • • 0-• • • • • • • . -· • ·-----J:<"_ .--, -----• ·-• • JI-------• • • • • • • • • • • • • • • • • • • • I I I '1 I I I '1 I I 't 11, ______ j • • • • • • I • • • • • • • • • • • • • ~ • • • • f,,, ',, ', • • • -=.::.-=.--=,;---+--::-1. ____ _;,s:.-,~ • • • • • • • • • • • • • • • " E ~ 0 0 ~ z rn C .£!l E "' g, > £ :0 i5 ~ z w ::, C t 0 0 3: 0 _Q ,.:. -0 N ::, " __, R 00 00 00 )LOHQDPH & ?8VHUV?PDUJDUHWFDOODQ?'HVNWRS?*RXOG0LQL6WRUDJH/D\RXW$$*,The Lighting Analysis, ezLayout, Energy Analysis and/or Visual Simulation ("Lighting Design") provided byRAB Lighting Inc. ("RAB") represents an anticipated prediction of lighting system performance based upon designparameters and information supplied by others. These design parameters and information provided by others havenot been field verified by RAB and therefore actual measured results may vary from the actual field conditions.RAB recommends that design parameters and other information be field verified to reduce variation.RAB neither warranties, either implied or stated with regard to actual measured light levels or energy consumptionlevels as compared to those illustrated by the Lighting Design. RAB neither warranties, either implied or stated, norrepresents the appropriateness, completeness or suitability of the Lighting Design intent as compliant with anyapplicable regulatory code requirements with the exception of those specifically stated on drawings created andsubmitted by RAB. The Lighting design is issued, in whole or in part, as advisory documents for informational purposesand is not intended for construction nor as being part of a project's construction documentation package.Scale: as notedDate:2/14/2022Filename: Gould Mini Storage Layout 00804287A.AGIDrawn By:Margaret KoenigNOTES:* The light loss factor (LLF) is a product of many variables, only lamp lumen depreciation (LLD)has been applied to the calculated results unless otherwise noted. The LLD is the result (quotient)of mean lumens / initial lumens per lamp manufacturers' specifications.* Illumination values shown (in footcandles) are the predicted results for planes of calculationeither horizontal, vertical or inclined as designated in the calculation summary. Meter orientationis normal to the plane of calculation.* The calculated results of this lighting simulation represent an anticipated prediction of systemperformance. Actual measured results may vary from the anticipated performance and are subjectto means and methods which are beyond the control of RAB Lighting Inc.* Mounting height determination is job site specific, our lighting simulations assume a mountingheight (insertion point of the luminaire symbol) to be taken at the top of the symbol for ceilingmounted luminaires and at the bottom of the symbol for all other luminaire mounting configurations.* It is the Owner’s responsibility to confirm the suitability of the existing or proposed poles and basesto support the proposed fixtures, based on the weight and EPA of the proposed fixtures and the owner’ssite soil conditions and wind zone. It is recommended that a professional engineer licensed to practicein the state the site is located be engaged to assist in this determination.* The landscape material shown hereon is conceptual, and is not intended to be an accuraterepresentation of any particular plant, shrub, bush, or tree, as these materials are living objects,and subject to constant change. The conceptual objects shown are for illustrative purposes only.The actual illumination values measured in the field will vary.* Photometric model elements such as buildings, rooms, plants, furnishings or any architecturaldetails which impact the dispersion of light must be detailed by the customer documents for inclusionin the RAB lighting design model. RAB is not responsible for any inaccuracies caused by incompleteinformation on the part of the customer, and reserves the right to use best judgement when translatingcustomer requests into photometric studies.* RAB Lighting Inc. luminaire and product designs are protected under U.S. and International intellectualproperty laws. Patents issued or pending apply.Prepared For:Electrical Lines10600 E 54th Ave DrUnit D & EDenver, CO 80239Tel: 303-722-5721Lighting LayoutVersion AJob Name:Gould Mini StorageGlenwood Springs, COCASE # 00804287PROJECT # 161165Luminaire Schedule All quotes/orders generated from this layout must be forwarded to the Local Rep AgencySymbolQtyTagLabelArrangementCalculation SummaryLLFDescriptionBUG Rating LabelCalcTypeUnitsAvgMaxMinAvg/MinMax/MinPtSpcLrPtSpcTbMeter TypeGrid ZEntry and ParkingIlluminanceFc8A2.287.00.37.6023.331010Horizontal0ExitIlluminanceFc2.686.11.12.44ALED3T50SINGLE1.000Pole Mounted (Type III)B1-U0-G25.551010Horizontal0Left Storage UnitsIlluminanceFc3.3220.20.0N.A.N.A.10172BSLIM18SINGLE1.000Wall MountedB1-U0-G010Horizontal0Right Storage UnitsIlluminanceFc3.6720.20.0N.A.N.A.1010Horizontal0Plan ViewIso View )LOHQDPH & ?8VHUV?PDUJDUHWFDOODQ?'HVNWRS?*RXOG0LQL6WRUDJH/D\RXW$$*,The Lighting Analysis, ezLayout, Energy Analysis and/or Visual Simulation ("Lighting Design") provided byRAB Lighting Inc. ("RAB") represents an anticipated prediction of lighting system performance based upon designparameters and information supplied by others. These design parameters and information provided by others havenot been field verified by RAB and therefore actual measured results may vary from the actual field conditions.RAB recommends that design parameters and other information be field verified to reduce variation.RAB neither warranties, either implied or stated with regard to actual measured light levels or energy consumptionlevels as compared to those illustrated by the Lighting Design. RAB neither warranties, either implied or stated, norrepresents the appropriateness, completeness or suitability of the Lighting Design intent as compliant with anyapplicable regulatory code requirements with the exception of those specifically stated on drawings created andsubmitted by RAB. The Lighting design is issued, in whole or in part, as advisory documents for informational purposesand is not intended for construction nor as being part of a project's construction documentation package.Scale: as notedDate:2/14/2022Filename: Gould Mini Storage Layout 00804287A.AGIDrawn By:Margaret KoenigElectrical Lines10600 E 54th Ave DrPrepared For:Unit D & EDenver, CO 80239Tel: 303-722-5721Job Name:Gould Mini StorageGlenwood Springs, COLighting LayoutVersion ACASE # 00804287PROJECT # 161165Expanded Luminaire Location SummaryLumNoTagXYMTG HTExpanded Luminaire Location SummaryExpanded Luminaire Location SummaryLumNoTagXYMTG HTOrientTiltOrientTiltLumNoTagXY1B2347.438699.8048270MTG HTOrient02B2306.439699.6138Tilt270067B1921.58611.1468133B1118.144499.45383B2261.439699.3888270018002780134A4B2216.44699.19582700568B2161.592611.14681800B2171.44698.9858270069B2122.164609.39681379.075496.00815930135B1073.5586B2106.34698.699827000070B2322.267609.396493.36382780136B1217.925490.482808987B2061.34698.485071B1490.275608.3628273072B1445.3490137B1028.972487.2728605.7868273082780138B2701221.788485.801880073B1840.253606.039893074B1877.525603.6048139B1184.043485.8518988B3075B1795.753603.495893076B1749.254600.837893002016.341698.263818B2238.59676.882890019B27009B1971.341698.0538270010B1924.636697.8368270011B1858.834692.6298273012B1813.834690.098273013B1768.835687.5438273014B1723.835684.9978273015B1677.13682.3538273016A1400.629679.87415134017B2283.589677.09389002193.091676.668890020B2083.49676.19890021B2038.491675.976890022B1992.992675.76890023B1946.287675.538890024B2121.795674.85380025B2321.898674.85380026B1921.261671.2968180027B2161.309671.2968180028B1835.952668.899893029B1790.953666.327893030B1874.003665.32883031B1745.454663.726893032B1698.749661.056893033B1673.739652.9428183034B2121.9646.97180035B2322.003646.97180036B1634.729645.51883037B1921.364643.7968180038B2161.412643.7968180039B1875.603637.44683040B2309.74636.6148270041B2264.739636.4578270042B2219.74636.2888270043B2174.741636.1198270044B2109.641635.7138270045B2064.641635.4998270046B2019.642635.2868270047B1974.643635.0728270048B1929.148634.8568270049B1862.135629.7128273050A1347.664626.44815148051B1817.135627.148273052B1675.332625.4428183053B1772.136624.5688273054B1636.017622.71983055B1727.137621.9958273056B1681.642619.3958273057B1625.053616.098273058B1580.127613.5148273059B2287.89614.078890060B2243.39613.868890061B2196.891613.657890062B2087.791613.209890063B2043.291612.998890064B1996.792612.777890065B1951.297612.561890066B1535.201610.93882730Total Quantity: 180 ( 66 shown, 1 through 66 )77B1703.759598.236893078B89B2286.541573.5048270090B2242.04573.2968270091B2194.041573.0698270092B2086.442572.602827001604.127592.468893079B1637.784591.60983080B1677.255591.5778183081B1557.516589.797893082B1513.482587.289893083B1467.565584.643893084B1921.706579.2218180085B2161.718579.2218180086B2122.32577.24380087B2322.328577.24380088B1457.859574.7838183093B2041.941572.398270094B1993.942572.1628270095B1946.753571.9388270096B1879.37571.45183097B1838.936565.288273098B1794.435562.7368273099B1746.436559.99282730100B1639.629559.684830101B1679.087559.65281830102A1304.551559.2671530103B1699.247557.29582730104B1619.043552.63982730105B2352.212551.5088900106B2307.213551.2848900107B2262.213551.0598900108B1574.119550.06482730109B2217.214550.8348900110B2172.214550.618900111B2107.115550.2828900112B1459.31549.50781830113B2062.115550.0738900114B2017.116549.8638900115B1972.115549.6468900116B1924.926549.4348900117B1529.194547.52682730118B1484.269544.92782730119B1859.577544.0388930120B1814.577541.4688930121B1769.578538.8988930122B1724.577536.3288930123B1683.922533.9548930124B1633.342531.0568930125B1588.413528.4828930126B1543.484525.9098930127B1508.122523.8888930128B1460.463521.1928930129B1251.902517.72582780130B1420.118518.8458930131B1207.316511.63482780132B1162.73505.54482780Total Quantity: 180 ( 66 shown, 67 through 132 )140A1308.424488.5761520141B984.387481.18282780142B1138.85479.6758980143B933.207474.19182780144B1095.36473.7318980145B888.62468.182780146B1050.287467.5718980147B844.033462.02682780148B1005.823461.4948980149B1225.269460.029880150A1284.558456.713152760151B799.448455.91982780152B983.476452.61281880153B754.863449.82682780154B1219.392449.73282780155B914.25448.9958980156B944.356448.017880157B1188.445445.46882780158B716.789444.62982780159B869.191442.7988980160B1158.246441.37582780161B1128.644437.32982780162B826.599436.998980163B1096.925432.96282780164B780.848430.798980165B1064.984428.63282780166B986.919426.85581880167B1033.67424.26782780168B947.837422.245880169B1002.775420.00382780170B745.671419.92581880171B944.306412.10682780172B914.111407.98482780173B884.508403.94382780174B852.784399.61282780175B820.847395.25282780176B749.114394.16881880177B789.521390.97682780178B758.62386.75782780179A699.374368.506152820180A623.176347.105152870Total Quantity: 180 ( 48 shown, 133 through 180 )I I ® E ~ 0 ~ 0 rn ~ C ~E -;;; rn > :.= £ .D i5 ~ z w ::> C !JI 0 <( 0 3: S' 0 ' -"' "O "' ::> "-__, 00 R oo -00 ALED3T50 Need help? Tech help line: (888) 722-1000 Email: custserv@rablighting.com Website: www.rablighting.com Copyright © 2020 RAB Lighting All Rights Reserved Note: Specifications are subject to change at any time without notice Page 1 of 3 Color: Bronze Weight: 32.5 lbs Project:Type: Prepared By:Date: Driver Info Type Constant Current 120V 0.46A 208V 0.27A 240V 0.23A 277V 0.20A Input Watts 55.17W Efficiency 91% LED Info Watts 50.00W Color Temp 5000K (Cool) Color Accuracy 71 CRI L70 Lifespan 100,000 Lumens 6,855 Efficacy 124.3 LPW Technical Specifications Listings UL Listed: Suitable for wet locations as a downlight IESNA LM-79 & IESNA LM-80 Testing: RAB LED luminaires and LED components have been tested by an independent laboratory in accordance with IESNA LM-79 and LM-80. Dark Sky Conformance: Conforms to (allows for conformance to) the IDA's fully shielding requirement, emitting no light above 90 degrees (with the exclusion of incidental light reflecting from fixture housing, mounts, and pole). LED Characteristics Lifespan: 100,000-hour LED lifespan based on IES LM-80 results and TM-21 calculations LEDs: Multi-chip, high-output, long-life LEDs Color Consistency: 7-step MacAdam Ellipse binning to achieve consistent fixture-to-fixture color Color Stability: LED color temperature is warrantied to shift no more than 200K in CCT over a 5-year period Color Uniformity: RAB's range of CCT (Correlated Color Temperature) follows the guidelines of the American National Standard for Specifications for the Chromaticity of Solid State Lighting (SSL) Products, ANSI C78.377-2017. Construction IES Classification: The Type III distribution is ideal for roadway, general parking and other area lighting applications where a larger pool of lighting is required. It is intended to be located near the side of the area, allowing the light to project outward and fill the area. IP Rating: Ingress Protection rating of IP66 for dust and water Ambient Temperature: Suitable For use in 40°C (104°F) Cold Weather Starting: Minimum starting temperature is -40°C (-40°F) Thermal Management: Superior thermal management design with external Air-Flow fins provides maximum operational life, even in high ambient temperature environments Effective Projected Area: EPA = 0.75 Housing: Die-cast aluminum housing, lens frame and mounting arm Mounting: Universal mounting arm compatible for hole spacing patterns from 1" to 5 1/2" center to center. Round Pole Adaptor plate included as a standard. Easy slide and lock to mount fixture with ease. Round pole diameter must be >4" to mount fixtures at 90° orientation. Reflector: Specular vacuum-metallized polycarbonate Gaskets: High-temperature silicone gaskets Finish: Formulated for high durability and long-lasting color Green Technology: Mercury and UV free. RoHS-compliant components. .) ALED3T50 Need help? Tech help line: (888) 722-1000 Email: custserv@rablighting.com Website: www.rablighting.com Copyright © 2020 RAB Lighting All Rights Reserved Note: Specifications are subject to change at any time without notice Page 2 of 3 Technical Specifications (continued) Electrical Driver: Constant Current, Class 2, 1400mA, 100-277V, 50-60Hz, 0.8A, Power Factor 99% THD: 6.1% at 120V, 9.4% at 277V Power Factor: 99.6% at 120V, 96% at 277V Surge Protection: 6kV surge suppression protection tested in accordance with IEEE/ANSI C62.41.2. Other Patents: The ALED™ design is protected by patents pending in the U.S., Canada, China, Taiwan and Mexico. BAA Compliance: Click here for BAA compliance. Warranty: RAB warrants that our LED products will be free from defects in materials and workmanship for a period of five (5) years from the date of delivery to the end user, including coverage of light output, color stability, driver performance and fixture finish. RAB's warranty is subject to all terms and conditions found at rablighting.com/warranty. Equivalency: Replaces 200W Metal Halide Buy American Act Compliance: RAB values USA manufacturing! Upon request, RAB may be able to manufacture this product to be compliant with the Buy American Act (BAA). Please contact customer service to request a quote for the product to be made BAA compliant. Optical BUG Rating: B1 U0 G2 Dimensions Features 66% energy cost savings vs. HID 100,000-hour LED lifespan 5-Year, No-Compromise Warrantyl ~~~~~~ l T ~~ ~~~ l ALED3T50 Need help? Tech help line: (888) 722-1000 Email: custserv@rablighting.com Website: www.rablighting.com Copyright © 2020 RAB Lighting All Rights Reserved Note: Specifications are subject to change at any time without notice Page 3 of 3 Ordering Matrix Family Optics Wattage Mounting Color Temp Finish Driver Options Options Other Options ALED 3T 50 4T = Type IV 3T = Type III 2T = Type II 50 = 50W 78 = 78W 105 = 105W 125 = 125W 150 = 150W Blank = Pole mount SF = Slipfitter Blank = 5000K (Cool) N = 4000K (Neutral) Y = 3000K (Warm) Blank = Bronze RG = Roadway Gray W = White K = Black Blank = 120-277V /480 = 480V /BL = Bi-Level /D10 = 0-10V Dimming Blank = No Option /LC = Lightcloud® Controller /PCS = 120V Swivel Photocell /PCS2 = 277V Swivel Photocell /PCT = 120-277V Twistlock Photocell /PCS4 = 480V Swivel Photocell /PCT4 = 480V Twistlock Photocell /WS = Multi-Level Motion Sensor /WS2 = Multi-Level Motion Sensor 20 ft. /WS4 = Multi-Level Motion Sensor 40 ft. Blank = Standard USA = BAA Compliant DI II I._I _____ II II II II II I _) PS4-11-15D2 Need help? Tech help line: (888) 722-1000 Email: custserv@rablighting.com Website: www.rablighting.com Copyright © 2019 RAB Lighting All Rights Reserved Note: Specifications are subject to change at any time without notice Page 1 of 2 Square steel poles drilled for 2 Area Lights at 180°. Designed for ground mounting. Poles are stocked nationwide for quick shipment. Protective packaging ensures poles arrive at the job site good as new. Color: Bronze Weight: 105.8 lbs Project:Type: Prepared By:Date: Technical Specifications Listings CSA Listed: Suitable for wet locations Construction Shaft: 46,000 p.s.i. minimum yield. Hand Holes: Reinforced with grounding lug and removable cover Base Plates: Slotted base plates 36,000 p.s.i. Shipping Protection: All poles are shipped in individual corrugated cartons to prevent finish damage Color: Bronze powder coating Height: 15 FT Weight: 106 lbs Gauge: 11 Wall Thickness: 1/8" Shaft Size: 4" Hand Hole Dimensions: 3" x 5" Bolt Circle: 8 1/2" Base Dimension: 8" Anchor Bolt: Galvanized anchor bolts and galvanized hardware and anchor bolt template. All bolts have a 3" hook. Anchor Bolt Templates: WARNING Template must be printed on 11" x 17" sheet for actual size. CHECK SCALE BEFORE USING. Templates shipped with anchor bolts and available online. Pre-Shipped Anchor Bolts: Bolts can be pre-shipped upon request for additional freight charge Max EPA's/Max Weights: 70MPH 14.0 ft./400 lb. 80MPH 10.2 ft./295 lb. 90MPH 7.6 ft./220 lb. 100MPH 5.6 ft./165 lb. 110MPH 4.2 ft./125 lb. 120MPH 3.0 ft./95 lb. 130MPH 2.1 ft./70 lb. 140MPH 1.4 ft./50 lb. 150MPH 0.8 ft./35 lb.. Other Terms of Sale: Pole Terms of Sale is available online. RAB I Outdoor + .J .) PS4-11-15D2 Need help? Tech help line: (888) 722-1000 Email: custserv@rablighting.com Website: www.rablighting.com Copyright © 2019 RAB Lighting All Rights Reserved Note: Specifications are subject to change at any time without notice Page 2 of 2 Technical Specifications (continued) Other Buy American Act Compliance: RAB values USA manufacturing! Upon request, RAB may be able to manufacture this product to be compliant with the Buy American Act (BAA). Please contact customer service to request a quote for the product to be made BAA compliant. Dimensions Features Designed for ground mounting Heavy duty TGIC polyester coating Reinforced hand holes with grounding lug and removable cover for easy wiring access Anchor Bolt Kit includes pole cap and base cover (sold separately) Custom manufactured for each application RAB I Outdoor SLIM18 Need help? Tech help line: (888) 722-1000 Email: custserv@rablighting.com Website: www.rablighting.com Copyright © 2020 RAB Lighting All Rights Reserved Note: Specifications are subject to change at any time without notice Page 1 of 2 12, 18 and 26 Watt SLIM wall packs are ultra efficient and deliver impressive light distribution with a compact low-profile design that's super easy to install as a downlight or uplight. Color: Bronze Weight: 4.3 lbs Project:Type: Prepared By:Date: Driver Info Type Constant Current 120V 0.18A 208V 0.11A 240V 0.09A 277V 0.08A Input Watts 21.00W Efficiency 86% LED Info Watts 18.00W Color Temp 5100K (Cool) Color Accuracy 75 CRI L70 Lifespan 100,000 Lumens 2,565 Efficacy 122.1 LPW Technical Specifications Listings UL Listed: Suitable for wet locations. Suitable for mounting within 1.2m (4ft) of the ground. ADA Compliant: SLIM™ is ADA Compliant IESNA LM-79 & LM-80 Testing: RAB LED luminaires and LED components have been tested by an independent laboratory in accordance with IESNA LM-79 and LM-80. DLC Listed: This product is listed by Design Lights Consortium (DLC) as an ultra-efficient premium product that qualifies for the highest tier of rebates from DLC Member Utilities.DLC Product Code: PSPVC3C7 Construction IP Rating: Ingress Protection rating of IP66 for dust and water Cold Weather Starting: Minimum starting temperature is -40°C (-40°F) Maximum Ambient Temperature: Suitable for use in 40°C (104°F) Housing: Precision die-cast aluminum housing Mounting: Heavy-duty mounting bracket with hinged housing for easy installation Recommended Mounting Height: Up to 14 ft Lens: Tempered glass lens Reflector: Specular thermoplastic Gaskets: High-temperature silicone Finish: Formulated for high durability and long-lasting color Green Technology: Mercury and UV free. RoHS-compliant components. LED Characteristics LED: Multi-chip, long-life LED Lifespan: 100,000-hour LED lifespan based on IES LM-80 results and TM-21 calculations Color Consistency: 7-step MacAdam Ellipse binning to achieve consistent fixture-to-fixture color Color Stability: LED color temperature is warrantied to shift no more than 200K in CCT over a 5-year period RAB' .) SLIM18 Need help? Tech help line: (888) 722-1000 Email: custserv@rablighting.com Website: www.rablighting.com Copyright © 2020 RAB Lighting All Rights Reserved Note: Specifications are subject to change at any time without notice Page 2 of 2 Technical Specifications (continued) LED Characteristics Color Uniformity: RAB's range of CCT (Correlated Color Temperature) follows the guidelines for the American National Standard for Specifications for the Chromaticity of Solid State Lighting (SSL) Products, ANSI C78.377-2017. Other Patents: The design of the SLIM™ is protected by patents in U.S. Pat D681,864, and pending patents in Canada, China, Taiwan and Mexico. HID Replacement Range: Replaces 100W Metal Halide Warranty: RAB warrants that our LED products will be free from defects in materials and workmanship for a period of five (5) years from the date of delivery to the end user, including coverage of light output, color stability, driver performance and fixture finish. RAB's warranty is subject to all terms and conditions found at rablighting.com/warranty. Buy American Act Compliance: RAB values USA manufacturing! Upon request, RAB may be able to manufacture this product to be compliant with the Buy American Act (BAA). Please contact customer service to request a quote for the product to be made BAA compliant. Optical BUG Rating: B1 U0 G0 Electrical Driver: Constant Current, Class 2, 100-277V, 50/60 Hz., 4KV surge protection, 120V: 0.19A, 208V: 0.11A, 240V: 0.10A, 277V: 0.08A THD: 11% at 120V, 21% at 277V Power Factor: 99.2% at 120V, 91.5% at 277V Dimensions Features Full cutoff, fully shielded LED wall pack Can be used as a downlight or uplight Contractor friendly features for easy installation 100,000-hour LED Life 5-Year, No-Compromise Warranty Ordering Matrix Family Wattage Color Temp Finish Driver Options SLIM 18 12 = 12W 18 = 18W 26 = 26W Blank = 5000K (Cool) N = 4000K (Neutral) Y = 3000K (Warm) Blank = Bronze W = White Blank = Standard (120-277V) /D10 = Dimmable Blank = No Option /PC = 120V Button /PC2 = 277V Button /LC = Lightcloud® Controller 6.5" -165mm - i--::::::::::: 3.9" 99mm----, 8.75 ' 222mm □□~I _ _..l~l-~l~l __ ~l~I ____ I RAB' The Land Studio, Inc. 365 River Bend Way • Glenwood Springs, CO 81601 • Tel 970 927 3690 • landstudio2@comcast.net July 29, 2022 Glenn Hartmann Principal Planner Garfield County Community Development Re: Royal Mini Storage Limited Impact Review, Garfield County Sufficiency Comments (LIPA-04-22-8892) Dear Glenn: Thank you for contacting The Land Studio, Inc. with Garfield County’s sufficiency comments for the Royal Mini Storage Limited Impact Review Permit Application. The following are Applicant responses to Garfield County’s sufficiency comments. Please note that the Applicant’s responses are in bold below following each of the sufficiency comments received: 1. A Statement of Authority for MMME WG LLC needs to be provided, indicating the individual authorized to represent the LLC. The Applicant has completed this recording and a copy has been included with this letter. 2. The Application needs to address the status of previous approvals on the property and request their withdrawal if they are no longer active. There are no active Land Use Change Permits on the property. 3. The vicinity map needs to be upgraded to include areas within an approximately three-mile area. An updated vicinity map has been included with this letter. 4. The overall site plan needs to include all easements shown on the existing condition mapping to ensure that there are no conflicts with said easements. The overall site plan has been updated to include all easements shown on the existing condition map along with a letter from Michael J. Sawyer of KARP NEU HANLON, P.C. addressing easement locations. Both items have been included with this letter. 5. The proposed site is currently configured as two separate parcels. The Application needs to address how the property will be combined/merged as part of the development proposal. A letter from Michael J. Sawyer of KARP NEU HANLON, P.C. addressing the two separate parcels has been included as an Exhibit with this letter. 6. As part of the water supply plans for the project, pump tests and water quality testing need to be provided or waivers requested. This should include for the office use, customer ~~~~~. THE LAND STUD IO INC. l andscape arch i t ecture land planning community pl ann i ng The Land Studio, Inc. 2 needs/service, and both of the proposed employee housing units. A letter from Karp Neu Hanlon presenting the legal water supply for property owned by MMME WG LLC has been included as an Exhibit to this letter. Also included as an Exhibit is a letter from Zancanella and Associates, Inc discussing the physical and legal water supply for MME WG, LLC including pump tests and water quality testing results. 7. The project description should be updated/expanded to include details on the proposed office use. The Project Description 4-203.B has been updated and is included as an Exhibit to this letter. 8. The Project Narrative indicates that improvements to access are intended, and the Traffic study indicates that access will meet Section 7-107 standards. Additional details and roadway cross-sections need to be provided including for Highway 6. Compliance with off-street parking and circulation standards in Section 7-302 need to be documented. Site plan legends for road/driveway surfacing would be most helpful. Please see attached exhibit for the road section detail on Overall Site Plan C2.0. To further explain the standards are being met under section 7-107, we have provided the traffic counts, 39 Peak Am and 41 Peak Pm. These numbers place the road standards within the semi-primitive. While we are meeting and exceed some of these standards here is a table below to compare. Design Standards Semi Primitive Standards Mini Storage Design Design Capacity (ADT) 21-100 80 Minimum ROW 40 CDOT ROW Lane Width 8 12 Shoulder Width 2 0 Ditch Width 4 6 Cross Slope 2% Chip/Seal, 3% Gravel 2% Shoulder Slope 5% n/a Design Speed n/a n/a Minimum Radius 50 n/a Maximum Grade 12% 5.5% (tie in Highway 6 &24) Surface Gravel Asphalt A hammerhead emergency and maintenance vehicle turn around is provided at the entrance gate to the mini storage facility. The improved road will continue to all other phases of the mini storage development including the outdoor storage. Section 7-302: Off-Street Parking and Loading Standards, four parking spaces have been provided in front of the main office building, one of which is handicap. The employee housing unit near the office building has a carport designed to house two vehicles. The existing home to the west of the property has a space for two vehicles and a turn around. Section 7-302.N, Access Driveways: Access driveways are required to be 24 feet for a 2-way drive. The access road to this site is 24 feet in width and is adequate under this standard. The Land Studio, Inc. 3 9. The Traffic Analysis needs to be updated to provide additional information on emergency vehicle access including the use of turning models as appropriate. Please refer to the attached fire truck exhibit, sheet C2.6, for turn movements of an emergency vehicle. Sheet C2.6 has been included as an Exhibit to this letter. The letter provided to CDOT to update the Access Permit with the proposed traffic numbers as been provided with this response. 10. A complete copy of the CDOT Access Permit needs to be provided. A copy of the CDOT Access Permit has been included as an Exhibit to this letter. 11. The Landscaping Plan needs to be revised to meet the Land Use and Development Code standards and/or update descriptions of the areas to be re- vegetated and areas to be left undisturbed. The Landscape Plan has been updated and included as an Exhibit to this letter. 12. The project description needs to include additional information on how the storage units and outside storage yard will be accessed and/or secured beyond the representation that they will be fenced and gated (i.e., will Knox Box access be provided). The Project Description 4-203.B has been updated and is included as an Exhibit to this letter. 13. While site development avoids areas with 30% slopes, the grading of the site will create some areas with 30% or greater slopes. Engineering considerations and stabilization plans for these areas need to be more fully addressed. The Applicant agrees that if at any point, the contractor or civil engineer see the site soils being unstable on the proposed slopes erosion control mats will be placed to help stabilize the ground. All slopes will be hydraulically seeded and followed by application of hydraulically applied mulch or straw. Straw mulch shall be secured in place with a hydraulically applied tackifier. 14. Snow storage pursuant to Section 7-305 needs to be more fully addressed. A snow storage plan has been provided with attached sheet C2.5 Snow Storage Plan. The Land Studio, Inc. 4 Exhibits: R. Recorded Statement of Authority S. Updated Vicinity Map T. Updated Project Description and Conceptual Phasing Plan U. KARP NEU HANLON, P.C. easement and parcel boundary letter V. KARP NEU HANLON, P.C. legal water supply letter W. Zancanella and Associates, Inc letter concerning physical and legal water supply X. CDOT Access Permit documents Y. Landscape Plan Z. Updated Civil Plan Set from Sopris Engineering C1.1 Existing Conditions C2.0 Overall Site Plan C2.1 Site Plan C2.2 Site Plan C2.3 Site Plan C2.4 Site Plan C2.5 Snow Storage Plan C2.6 Fire Truck Movements C3.0 Overall Grading Plan C3.1 Grading Plan C3.2 Grading Plan C3.3 Grading Plan C3.4 Grading Plan C4.0 Utility Plan C4.1 OWTS Plan We look forward to working with you during your review of this project. Please email or call as needed. Kind regards, THE LAND STUDIO, INC By: Douglas J. Pratte STATEMENT OF AUTHORITY e·Garfield County STATEMENT OF AUTHORITY Pursua nt to C.R .S. §38-30-172, the undersigned executes this Statement of Authority on behalf of MMME WG a limited Uabllty Company (corpo ration, limited liabllity company, general partnership, registered limited liability partnership, registered limited liability limited partnership, limited partnership association, governmen t agency, trust or other), an entity other · than an individ ual, capable of holding title to real property (the "Entity"), and states as follows : The name of the Entity is .:..I _MMME __ w_G_L_L_c ___________________ _, and is formed under the laws of .:::S:.:::ta:_:::te:.:o:'..'..F..:::C~ol~ora~do:'....__ ________________ _ The mailing address for the Entity [s PO Box 130, Glenwood Springs, CO 81602 The name and/or position of the person authorized to execute Instruments conveyi ng, encumbering, or otherwise affecting title to real property on behalf of the Entity is ..'..:M~a~rk~C::..G~ou::::ld::_ _______ _ The limitations upon the authority of the person named above or holding the position described above to bind the Ent ity are as follows (if no limitations, Insert "None"): .:.:N:.:::o:.::ne::_ _________ _ Other matters concerning the manner in whlch the Entity deals with any interest in real property are (If no other matter, leave this section blank): ___________________ _ Slgnature:_..:_~~,,-,...,.~:.C...~,......(::::::,,o"a....V::.~"'4~_. Name (pr inted): _a_rk_C_G_o_u_ld _______ --4 __ Ti tl e (!f any): _M_a_na-=g'-er __________ __._ __ STATE OF .::C:.:.ol:.:.o:.::ra:.:..do=--____ } )SS . COUNTY OF ~G:..::a:..'.:rfl:.:::el:::_d _____ ) The foregolng instrument was acknowledged before me th is 2oth day of ..:J:.:.ul~y _____ __, 20~ by Mark C Gould on behalf of ~MMM~~E:........".W~G:.....:L:!::L'.::C:___ ______ __,, a Colorado Company Kimberly D Ochko [SE ALJNOTARY PIJ6UC . STATE OF COLORADO NOTARY iDI 20014003716 MY COMMISS IOfl EXPIRES 03f2J/2025 VICINITY MAP ~ ;a 0 '< !?. ~ 2 1 llll82000Ji '25' ::::, s:: ;::;: ~: '< U> s::: 0 ii3 I» co "C Cl) :;E .,=.. Cl) I !:!?. N G> 0 Cl) w ::J ::E 0 0 0 c.. r-~r $' c.. 3 -0 0) u ;a Cl) S . Cl) ::E )> -0 -0 ~r !:!: 0 ::J ~ h 2 18312100963 L 12 7 2 18518100900 2 18312300022 2 18517100097 fr w.::-,..1, 11 RJ > 10()QM 'T ! 13 2 1831]100964 I PROJECT DESCRIPTION AND CONCEPTUAL PHASING PLAN Royal Mini Storage West Glenwood Limited Impact Review Application 17 17 Project Description - 4-203.B The proposed project is for a mini storage facility on two parcels which total approximately 38 acres for the overall site. The site is located near Storm King Mountain, north of I-70, east of mile marker 113. The Royal Mini Storage West Glenwood facility will contain approximately 118,400 sq. ft of single-story storage to be developed as market demands with construction beginning in the fall of 2022 and opening for business in March of 2023. The Applicant is requesting a vesting period of 10 years to complete the project. Building permits for each phase will be applied for sequentially over a 10 year period of time. All revegetation of any disturbance will happen on a sequential basis as grading and construction is completed, reseeding will occur as noted on the Landscape Plan. An office space of approximately 160 SF will house the computer center for lighting and gate access code information. There will be no on-site employee however a computer technician will be able to access the computer center as needed for maintenance. A restroom will be available within the office space for use by any maintenance staff. The Applicant has included a photo of the proposed office building and electronic gate. Each storage unit will have an individual lock for security and the electronic gate will be activated with a specific code given to each mini storage client. An outdoor storage area will be provided as part of the proposed storage facility and will be surrounded with an 8’screened fence. Royal Mini Storage West Glenwood Limited Impact Review Application 18 18 Access to the storage facility will be from Highway 6 & 24, the applicant does intend to provide improvements to the access. Information regarding traffic and an access permit is included in a traffic report included in this application. Two Employee housing units are proposed as part of this application, one is an existing residential home, the other will be a new residence. Each home will be approximately 1,500 sq. ft. xx xxxxx xxx xxxxx xxxx xxx xxxxxx x5774 5786 5760 5 7 40 5730 5 7 4 0 57625 7 6 4 5 7 8 2 5 7 9 2 5780 5784 57805 7 7 0 5 7 6 0 5 7 5 0 Phase 1 Phase 2 Phase 3 Phase 4 Phase 1 or 4 Royal Mini Storage West GlenwoodGarfield County, Coloradodate: remarks: 1 CONCEPTUAL PHASING PLANJULY 27, 2022The LAND Studio 365 River Bend Way Glenwood Springs, CO 81601 970.927.3690 landstudio2@com cast.net LEGEND I I. I I I ' I I I ~ -~ ~ ..,---C ~._ _,, -.c··=------..;;e-·=~ ___ ,.-•--•-_-a ----'>··--••·"'-··~·--2·-=--'"-·----=~------------c-•'·J-__ ----"-=•c--•·0 ______ J-----•---•----·----•-_ -:> --✓ ___ -;:'C::·j-=-•tt:7:=,.:.;:;_,.;..,;,--_~-- /:•l • -:•c-·-·\ ;P)dYJ l .' fff'" , , , :,< , , • , , c\·_·-: .. ,:··-:·:-_.:--__ \---\ : , , , ·~~ -~~-51~ ~~ -~il~ ~ ~I =---1 I ~-__ _JI Ii\~~ I ,1n\\ ::r M. ~~ KARP NEU HANLON, P.C. EASEMENT AND PARCEL BOUNDARY LETTER www.mountainlawfirm.com Michael J. Sawyer Partner/Shareholder mjs@mountainlawfirm.com Direct: 970.928.2118 Office: 970.945.2261 Fax: 970.945.7336 *Direct Mail to Glenwood Springs Glenwood Springs – Main Office 201 14th Street, Suite 200 P. O. Drawer 2030 Glenwood Springs, CO 81602 Aspen 323 W. Main Street Suite 301 Aspen, CO 81611 Montrose 1544 Oxbow Drive Suite 224 Montrose, CO 81402 July 27, 2022 Doug Pratte The Land Studio 365 Riverbend Way Glenwood Springs, CO 81601 Sent via email RE: Easements impacting land owned by MMME WG LLC Dear Doug: I have been asked to respond to items 4 and 5 in the letter from Glenn Hartmann dated June 20, 2022. Please include this letter and the exhibits in your submittal to Garfield County. 4. The overall site plan needs to include all easements as shown on the existing condition mapping to ensure that there are no conflicts with said easements. Exhibit A attached to this letter (Sopris Engineering Sheet C-2.0) depicts the proposed mini-storage development of the MMME WG LLC (“MMME”) property in relationship to easements identified in the Commitment for Title Insurance issued by Commonwealth Title Company (File No. 1906063.1). The mini-storage development is roughly bisected by a proposed access road running north-south that connects the office with the frontage road along Interstate 70. For the portion of the development to the east of the access road, Exhibit A demonstrates that none of the recorded easements will be impacted. In the area of the access road and to the west, there are certain easements that are located in areas where mini-storage development will occur. One of these is a 30’ access and utility easement that benefits two properties located to the north. (Title Commitment exception nos. 20, 21, and 22). The applicant understands that prior to the development of mini-storage units to the west of the access road, these easement rights will need to be relocated. Similarly the 10’ easement for Mountain States Telephone and Telegraph (Title Commitment exception no. 16) also is impacted by the proposed mini-storage development west of the access road. Again, MMME understands that this easement must be relocated prior to development of mini-storage at the depicted location. MMME recommends that the following condition of approval be included to prevent interference with the 30’ access and utility easement and the 10’ telephone easement: Prior to the issuance of a building permit for any mini-storage building west of the “access road” that impacts either the 30’ access and utility easement or the 10’ telephone easement identified in the Page 2 application submittals, Owner shall present evidence that said easement(s) have been relocated out of the area of the proposed building. 5. The proposed site is currently configured as two separate parcels. The Application needs to address how the property will be combined/merged as part of the development proposal. As identified on Exhibit A, all of the mini-storage improvements located to the east of the access road (including the access road itself) are physically located on Parcel A of the Amended Dever Subdivision Exemption. Applicant intends to initially develop the improvements located exclusively on Parcel A. As such, all of the improvements located on Parcel A can be developed without implicating the property boundary with Parcel B. MMME recommends that the following condition of approval be included to address mini- storage improvements that will cross over the common boundary of Parcels A and B: Prior to the issuance of a building permit for any mini-storage building west of the “access road,” Owner shall submit proof that the common property boundary between Parcel A and Parcel B of the Amended Dever Subdivision Exemption has been relocated or dissolved so that all of the mini- storage improvements are located on one legal parcel and do not extend over a parcel boundary. Please let me know if there is additional information helpful to address these items. Very truly yours, KARP NEU HANLON, P.C. Michael J. Sawyer MJS: enclosures Karp.Neu.Hanlon ::: ATTORN EYS AT LAVI ROWROWROWROWROWROWROWue ue ueueu e ue ue ue ue ue ue ue ue ueueueueueoe oe oe oe oe oe oe oe oeoexxxxxxxA1 A2 A3 A4 A5 A6 A7 OUTDOOR STORAGE EXISTING LEECH FIELD PROPERT Y L I N E PROPERTY LINE PROPERTY LINE PROPERTY LINE PROPERTY LINE PROPERTY LINEC1 C2 C3 C4 EMPLOYEE HOUSING OFFICE EXISTING HOME C5 B1 B2 B3 B4 B5 B6 B7 B8 C2.1 30' ACCESS AND UTILITY EASEMENT BUREAU OF LAND MANGEMENT RICHARD DEVER REC. # 570056 BURIED ELECTRICAL LINE 10' MTN STATES TELEPHONE EASEMENT EXISTING ELECTRIC VAULT EXISTING ELECTRIC TRANSFORMER 12X16' WELL BUILDING DEVER WELL #1 EXISTING RESIDENTIAL STRUCTURE EXISTING BURIED PROPANE TANK EXISTING FIRE HYDRANT WELL BUILDING 12X13' DEVER WELL #3 30' ACCESS EASEMENT 14' POWERLINE EASMENT 18' POWERLINE EASEMENT PARCEL A 24.42 ACRES ± PARCEL B 14.48 ACRES ± HIGHWAY 6&24 INTERSTATE 70 WEST BOUND EXISTING CULVERT EXISTING CULVERT EXISTING CULVERT EXISTING CULVERT EXISTING CULVERT EXISTING CULVERT OVERHEAD ELECTRICAL LINE DEVER WELL #2 15' 10' MTN STATES TELEPHONE EASEMENT OPRISES NGINEERING, LLC. CIVIL CONSULTANTS 19137.01JOB NO. DATE: 502 MAIN STREET CARBONDALE, CO 81623 (970) 704-0311 FAX: (970)-704-0313 DESIGNED BY DRAWN BY CHECKED BY AD AD YN DATE REVISION C-2.0 DRAWING NO. TITLE G:\2019\19137\CIVIL\CIVIL DWGS\PLOT\LIMITED IMPACT REVIEW COMPLETLESS\19137 C2.0 SITE PLAN.DWG - Jul 28, 2022 - 7:24amNORTHOVERALL SITE PLANROYAL MINI STORAGE AT WEST GLENWOODGARFIELD COUNTY, COLORADOLIMITED IMPACT REVIEW1 inch = ft. ( IN FEET ) GRAPHIC SCALE 075 75 150 75 30037.5 MEMBER UTILITIES FOR THE MARKING OF UNDERGROUND BEFORE YOU DIG, GRADE, OR EXCAVATE CALL 2-BUSINESS DAYS IN ADVANCE .QRZZKDW V 5 SHT C2.3 SHT C2.2 SHT C2.4 SHT C2.1 07-28-22 02/11/22 02/11/22 07/22/22 N.T.S. ℄ 12' DRIVE LANE 8" OF CLASS 6 12' DRIVE LANE 12" CLASS 2 6' 1.5' 2:1 SLOPE 2:1 SLOPE 2% CROSS SLOPE N.T.S. AS SHOWN ON PLANS 5' MINIMUM OR N.T.S. 4" OF ASHPALT SHEET KEY PROPOSED ASPHALT PAVEMENT PROPOSED CONCRETE/SIDEWALK PROPOSED GRAVEL/ROAD BASE EXISTING SWALE OR DITCH>>>> PROPOSED FENCEx PROPOSED LEGEND y,//d 6" (TYPJ r 4000 PSI CONCRETE 2'6 CROSS SLOPE (TYP) TOW~DS ROAD. Cl..6 BASE COURSE CONTINUED FROM STREET. STRIP Afl TOP SOil AND a.AV, SCARIFY SUBGRAOE, RECOMPACTTO 95% MIN. STANDARD PROCTOR. CONCRETE DETAIL _l '" T --------== r, ____ 41r'--2.-0' ---I 6" 111/2" _1___ sr CONCRETE Cl6 BASE COURSE CONTINUED FROM STREET. STRIP ALL TOP SOIL AND CLAY, SCARIFY SU BG RADE, RECOMPACTTO 95% MJN. STANDARD PROCTOR. VALLEY PAN DETAIL 1 ASPHALTIC ROAD SECTION 1/C: ' I ~CJ I --~[i:L:@ .. • I ~- I ----~ ~ /" ---- below. Call before you dig. KARP NEU HANLON, P.C. LEGAL WATER SUPPLY LETTER www.mountainlawfirm.com Michael J. Sawyer Partner/Shareholder mjs@mountainlawfirm.com Direct: 970.928.2118 Office: 970.945.2261 Fax: 970.945.7336 *Direct Mail to Glenwood Springs Glenwood Springs – Main Office 201 14th Street, Suite 200 P. O. Drawer 2030 Glenwood Springs, CO 81602 Aspen 323 W. Main Street Suite 301 Aspen, CO 81611 Montrose 1544 Oxbow Drive Suite 224 Montrose, CO 81402 July 27, 2022 Doug Pratte The Land Studio 365 Riverbend Way Glenwood Springs, CO 81601 Sent via email RE: Water supply for mini-storage project owned by MMME WG LLC (updated letter) Dear Doug: This letter is a supplement to the letter I submitted on April 20, 2022 related to the legal water supply for property owned by MMME WG LLC (“MMME”). As described in that letter, the property is served by three wells (Dever Well Nos. 1, 2 and 3). Water usage for domestic and irrigation purposes is permitted under the Nott No. 1 Ditch water right (which is pre-Colorado River compact and historic user pool protected). Water usage for commercial (including fire protection) and temporary construction purposes will be undertaken pursuant to a water supply contract with the West Divide Water Conservancy District (“WDWCD”). Water usage for both temporary construction and for permanent operations will occur primarily from Dever Well Nos. 1 and 3. Since April 20, there is additional water related documentation to add to the application. First, WDWCD issued Water Allotment Contract #220519MMME(a) for 7.97 acre feet. Exhibit F. This meets both the short term construction water needs and the permanent commercial water requirements. Second, the Division of Water Resources has updated its well permitting records to reflect MMME as the owner of the property upon which the Dever Wells are located and used. Exhibit G. A separate letter will be submitted by Zancanella and Associates discussing the physical water supply for the property, including well pumping and water quality tests. Very truly yours, KARP NEU HANLON, P.C. Michael J. Sawyer MJS: enclosures WEST DIVIDE 'WATER CONSE RVA NCY D I STR I C T May 19, 2022 MMMEWGLLC Mark Gould PO Box 130 Glenwood Springs, CO 81602 Re: Appl ication to Lease Water Dear Mark, 818 Ta ug hcn ba ug h Blvd ., Suite I O 1 l~O. Box 14 78 Ri fl e, Colorad o 8 1650-1478 Tel: (970) 625-546 1 \"Veb: www.wdwcd .org E mail: wa rc r@wd wcd.o rg Enclosed is approved Water Allotment Contracts #220519MMME(a). The next step is to obtain a new well permit from the Colorado Division of Water Resources office in Glenwood Springs. A totalizing flow meter must be installed and maintained in good working order. Additiona ll y, monthly meter readings must be reported to the West Divide office by the 5th of each month. Non- compliance w ith measuring and reporting requirements are grounds for cancellation of this contract, which could result in action by the Colorado Division of Water Resources to curtail further use of the well. Sincerely yours , WEST DNIDE WATER CONSERVANCY DISTRICT cc Division No. 5 Water Resources Colorado River Engineering D i rect ors: Sam uel B. Po ncr Kel ly Couey R ich a rd L. Mc 1e ill Bruce E. Wa mpler D a n R. H arriso n WEST DIVIDE WATER CONSERVANCY DISTRICT APPLICATION TO LEASE WATER 818 Taugbenbaugh Blvd. #101, P. 0. Box 1478, Rifle, CO 81650 970-625-5461 wa1er@wdwcd.org 1. APPLICANT INFORMATION Name: MMME WG LLC Mailing Address: --=-P....aOa...=B=oc:.:x:....:l=-=3'-"0'--_________ _ Glenwood Springs, CO 81602 Telepho ne : 970-945-7291 Email: mark@gouldconstruction.com Authorized Agent: Mark Gould 2. COURT CASE#: Decree/Aug Plan Case Nos: ______________ _ 3. DETAILED DESCRIPTION OF PROPOSED WATER USE Example: Subdivision of land, expansion of use, pond augmentation, etc. Please fill out the appli cable sections in Nos. 4 -7 4. RESIDENTIAL USES Number of homes: _____ No ADU's Subdivision: YES NO No. Lots -------- Home garden/lawn irrigated area (sq ft): ________ _ Irrigation method: Flood Sprinkler Other Non-Commercial animal watering(#): _.=---- Fire Protection: _X~--- Pond Evaporation: Maximum Surface Area (acres) _____ _ Any use of pond other than evaporation, please describe method, rate and annual volume of diversion: 5. COMMERICIAL USES No. Units ____ Total commercial area (sq ft) ____ _ Description of Use(# employees, etc): Commercial Office Use -IAF 6. INDUSTRIAL USES Description of Use: See Attached Pond: YES NO Pond Evaporation: Maximum Surface Area (acres) _____ _ Any use of pond other than evaporation, please describe method, rate and annual volume of diversion : 7. DIRECT PUMPING CONTRACT# 220519MMME(a) MAP ID#: 770 DATE ACTIVATED 5/19/22 8. SOURCE OF WATER Structure Type: _____ Structure Name:Dever Wells 1-3 Source type: Surface ___ Groundwater ___ Storage __ _ Current Well Penn it # (attach copy) 84353-F, 84355-F, 31319-F 9. LOCATION OF STRUCTURE Assessors Parcel Number ____________ _ County: Quarter/Quarter: Quarter: Garfield SW 1/4 NE 1/4 Section: Township: Range: P.M. T6S R90W 6th Distance of Well from Section Lines : See attaclred well permits North: ________ East: _________ _ Well locati on physical address: .,.,.,.,-•ra•J<•""''"'f\M,raij•••ll<Jia"'~""•' 10. LAND ON WHICH WATER WILL BE USED (or attach) 49893 Hwy. 6&24, G lenwood Spri ngs, CO 8160 1 Number of Acres in Tract: ---"'38,e,,°'"04"------------ /,zc/usion into the District. ar Applicant expense. may be required. 11. SEWAGE SYSTEM Septic tank/absorption leach field: _X __ Central System: __ If Central System, District name: ---------- 12. VOLUME OF LEASED WATER (ACRE-FEET) Minimum of I acre-foot. exceot in Alsbury service area. __ ·. 7 , q7 Provide engineering data to support volume of water requested. Commercial, M unicipal, and Industrial Uses MUST provide diversion and consumption data on a monthly basis. A totalizing flow meter with remote readout is required to be installed and usage reported to WDWCD. Applicant expressly acknowledges it bas bad the opportunity to review the District's Water Allotment Contract and agrees this application is made pursuant and subject to th nd conditions contained therein. Applicant Signature Appli~!Va?;-L- ISSUED AS AREA B CONTRACT YES ____ NO_~X...__ __ Prinled portions of1his form, except difTcrenriated a dditions or deletions, have been approved and adoplcd by the W es! Divide Water Conservancy Dislrict. Form: WDWCD 202 1 APPLICATION APPLICANT:IMMME WG LLC WEST DIVIDE WATER CONSERVANCY DISTRICT WATER USE ESTIMATES -LAGGED DEPLETIONS Contract Amount w / 10% transit Loss = GEOLOGIC ZONE: ._I 8_1 __ __. JAN FEB MAR A PR MAY JUN JUL AUG SEP OCT NOV DEC TOTAL Total Contract Amount (AF) 7 .970 Lagged Depletions Amount (AF) 0.419 0.355 0 .329 0.353 0.472 0.660 0.918 1 .1 18 1.103 0.970 0.737 0 .536 7 .970 MMM E_Lagged 7.97 acre feet 5/24/2022 JAN FEB MAR APR MAY JUN JUL AUG SEP OCT NOV DEC TOTAL WEST DIVIDE WATER CONSERVANCY DISTRICT COLORADO, SILT. RIFLE, ALSBURY WATER USE ESTIMATES APPLICANT:._! ______ M_.M_.M __ E_W ___ G __ L=LC ______ __,! Contract Amount w/ 5% transit Loss = 7.97 acre feet {1) Unit Value: Irrigation Diversion (AFiac) 0.109 0.376 0.555 0.613 0.481 0.340 0.085 2.559 (1) (2) (3) (4) IRRIGATED AREA (SQ FT): 0 COMMERCIAL AREA (SQ FT): 0 NO. OF LIVESTOCK: 0 DWELLING UNITS:□ ELEVATION (MSL): 5750 Pond Location (2) Unit Value: Irrigation C.U. (AFiac) 0.087 0.301 0.444 0.490 0.385 0.272 0.068 2.047 EVAPORATION AREA (ACRE): 0 (3) (4) (5) Crushing and Crushing and Screening Div Screening CU Commerical (AF) (AF) Uses Div (AF) 0.09 0.09 0.08 0.09 0.09 0.08 0.75 0.75 0.08 0.75 0.75 0.08 0.75 0.75 0.08 0.75 0.75 0.08 0.75 0.75 0.08 0.75 0.75 0.08 0.75 0.75 0.08 0.75 0.75 0.08 0.75 0.75 0.08 0.09 0.09 0.08 7.02 7.02 1.00 (6) Commerical UsesCU(AF) 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.15 80% irrigation efficiency for sprinkler systems -Not Used Bluegrass Blaney Criddle assessment with Pochop adjustments -Not used Bluegrass Per Zancanella Water Use Estimate 100% consumptive use Transit Loss"' Contract Location Colorado/Silt/Alsbury 10.0% {11) {12) (13) Total Diversion TotalC.U. Total Contract (AF) (AF) Amount(AF) 0.192 0.102 0.114 0.173 0.102 0.114 0.833 0.762 0.847 0.833 0.762 0.847 0.833 0.762 0.847 0.833 0.762 0.847 0.833 0.762 0.847 0.833 0.762 0.847 0.833 0.762 0.847 0.833 0.762 0.847 0.833 0.762 0.847 0.173 0.102 0.114 8.035 7.169 7.966 (5) (6) Per Zancanella Water Use Estimate 15% consumptive use (11) (12) (13) Column (3) + Column (5) + Column (7) + Column (9) + Column (10) plus 10% transit loss Column (4) + Column (6) + Column (8) + Column (9)+ Column (10) Column (12) plus 10% transit loss Confidentiality Notice: This spreadsheet, Including all attachments, is for the sole use of the Intended recipients and may contain confidential and privileged information. Anv unauthorized review, use, disclosure, coovinr,, distribution or action taken in reliance on the contents of the Information contained in this soreadsheet is strictly orohiblted. MMME 5/24/2022 BUREA U O F LAND MANAGEM ENT MMM E WG LLC D V ER , RI CHARD THOMPS N STORM KING HUNTING RANCH LLC MMMEWG LLC • 1541 Ml CHELL CREEK L 13S 295357 4381928 .................... ,, ......... ....... ••" GLENWO D S PRINGS, C ITY C u ............. ,, .. 11 .. ,, .. ,, .. ,, ......... ,,an• , .•..• N w s STAT E OF COLORADO DEPARTMENT OF HIGHWAYS GLENWO D SPRINGS, CITY C ------ BUREAU OF LAND MANAGEMENT BUREAU F LAND MANAGEMEt\ ------------------- COLORADO Rnl£R ENli lNE ER I N6 E Lege nd ,.r ,.1,01 .-r&l , ... \Nater Conservancy District P.O. Box 1301 B1 _Bedrock_0_1000 Ri fle, CO 8 1650 0 0.015 0.03 0.06 Mi le s (970) 625-4933 Sources: Esri, HERE, Garmin, lntermap, incremen t P Cor p. GEBCO, USGS , FAO, NPS, NRCAN, GeoBase, IGN , Kadaster NL, Ordnance Survey, Esri Japan, METI, Esri China (Hong Kong), swisstopo, © OpenStreetMap cont1ributors, and the GIS User Community MMME WG LLC Well Locations Document Name: West_Divide_map Drawn:WR Approved : WR ate: 5/20/2022 Figu re: 1 Client: 1132-WDWC[ Ground Water (3) 1 result(s) removed from 'Reslllts' Structure Well DEVER WELL NO 1 \Jame DEVER WELL NO NDID 3905080 > :urrent•1n•Use -Actlvt Structl1re with contemporary ~1vers1on reccrrfs (Al Nater Source -GROUNDWATER COLORADO RIVER 4ssoc Perm: 30751 8J353 F t15soc Case No a W018A W16A9 W3569 _ocatron Ac ura!"y -D 9111e>d Structure Well DEVER WE LL NO 2 \Jame DEVER WELl NO 2 NDID = 3905081 > :urrent in Use Active Structure with cont emporary ~•versron records (A) Nater Source GROUNDWAHR COLORADO RIVER 4ssoc Pe,m t = 31320-84355-F 4s<0c Case No -W018,l Wl&lq Wl56° .ocat1on Accuracy D191t1zed Strutture Well DEVER WELL NO 3 \Jame c DEVER WELL NO 3 //DID 3905082 > '"'urrent-m-Use -,\ct ve Structure w,th contemporary ;l1Vers1on records (A) Nater Sollrce -GROUNDW/\T(R COLORADO RIVER 4ssor Permit -31319 !3'135,1 f ~ssoc Case No -W0184 W16d9. W,569 oration Accuracy D19.mt"d Displaying 1 • 3 (Total. 3) ◄I ◄ Page 1 o f 1 ► I ► ~ Ground Wate, (3) X WEST DIVIDE WATER CONSERVANCY DISTRJ CT WATER ALLOTMENT CONTRACT CON T RAC T # 220519MM ME(a) MAP ID#: 770 DATE ACT IVATE D 5/19/22 Nam e of Applicant: __ (V) __ m __ tn_=E------"W'--6-"----y __ UJ__ _____________ _ Qu antity of Water in Acre Feet: ________ 1___,.:..-.:..:_9~7----'~--~~~~----------------- A pplicant, here by applies to th e West Di vid e Wa ter Co nservancy Di s tri ct, a po litical subd ivis ion of th e State o f Col orado, organized pursuant to and ex is ting by virtue o f C .R.S. 1973 , Sectio n 37-45-1 0 I , et seq., (he re in after referred to as the "Di stri ct") for a n a ll otm ent contract to be ne ficiall y and pe rp etu al ly use wa ter or water ri ght s owned, leased, or he reaft er acquire d by the Di strict. By execution of thi s Con tract and th e anached Applica tion , Applica nt here by ag rees to the foll o w ing te rm s and conditio ns: I. Wa ter Ri ghts : Applicant shall own wate r ri g hts at th e po int of di ve rs io n he re in law full y entitling A ppli cant to di ve rt water, which w ill be s uppl e mented and aug me nt ed by water leased he re in. If App lica nt int e nd s to <li ven thro ugh a we ll , it must be un de rstood by Applicant that no ri ght to di ve rt ex is ts un til a va li d we ll permit is obtained fro m th e Co lorado Di vis io n of Water Re sources . 2. Ouanti tv: Wate r appli ed fo r by th e Applicant in th e a mo unt set fo rt h above shall be diverted at App licant's point o f di ve rs ion from th e Di strict's direct flow wa te r ri g hts, and when wa ter is un availab le fo r divers io n pursua nt to ad mini strati on by the Co lorado State Eng ineer during pe riods wh e n said direct fl ow wat er ri ght is no t in priority, the Di stri ct shall release fo r t he use of A ppli cant up to said quan ti ty in acre feet per year o f storage wate r ow ned o r cont ro ll ed by th e Di stric t. It is und e rstood th at any qu antity alloued fro m direc t fl ow, storage or otherwise, to the Applicant by th e Di strict will be li mit ed by t he pri ority o f the Di st ric t's decrees a nd by the phys ical and legal availability o f water fr om Di strict's sources. Any qu antity alloued will o nl y be prov id ed so lo ng as water is avail a ble a nd the App li cant full y com plies wi th a ll o f the te rm s and conditions o f this Co ntrac t. The Di strict an d the A pp licant recogni ze th at so me o f the Di str ic t's decrees may be in the name o f the Colorado Ri ver Wate r Co nservation Di stri c t, and the abili ty of the Di stri c t to all ot d irec t fl ow rig ht to the Applicant may be depende nt o n th e consent of th e Co lorado Ri ver Wa ter Co nser vat ion Di stri ct. I f a t a ny tim e th e Appli can t determi nes it requ ires less water th an t he amount herein pro vided, A ppli cant may so notify th e Dis tri ct in writing, and the a mo unt of water a ll ott ed und er t his Contract shall be redu ced perman en tl y in accordance w ith s uch notice. Rates shall be adjusted according ly in foll o wing wate r years o nly . Bene fi cial Use an d Location o f Benefi cial Us e : Any and a ll wate r all o tted Applicant by th e District sha ll be used fo r th e fo ll owing benefic ial use or uses: industrial , muni cipal , domestic a nd related uses, o r comm ercial (except fo r comm e rcia l use fro m A lsbury Reservo ir a nd except to th e exte nt th at Ru edi Reservo ir wat er may no t be ava il ab le for comm ercial as tha t te rm is defined on Page 5 o f Contract No. 2-07-70-WO547 between th e Unite d St ates a nd th e Wes t Divi de Wa ter Co nservan cy Di strict). A ppli can t's be ne fi c ia l use o f any and a ll water allotted s hall be within or throug h fac ilities or up o n la nd owned, leased , ope rat ed, o r under App li cant's control. 4. Dec rees and Deli ve ry : Exc han ge re leases made by th e Di stri ct out of storage from Ruedi Reservo ir, Green Mo unta in Reservoir, Al s bury Reservoir, or othe r wo rks o r fac ilities o f th e District , or fr o m o the r sources available 10 the Di strict , sha ll be de li vered to th e Applicant at the outlet works of said storage fa ci liti es or at th e decreed po int of d iversi on for said ot he r so urces , and re lease or de li very o f wa ter at such outlet or points shall constitute perform ance of the Di stri ct's tota l o bli gati on. Deli very of water by the Di stri ct fr om Ru edi Re servoir or Green 1 Mountain Reservoir shall be subject to the District's lease contracts with the United States Bureau of Reclamation. Releases from other facilities available to District shall be subject to the contracts, laws, rules, and regulations governing releases therefrom. Furthermore, the District hereby expressly reserves the right to store water and to make exchange releases from structures that may be built or controlled by the District in the future, so long as the water service to the Applicant pursuant to this agreement, is not impaired by said action. Any quantity of the Applicant's allocation not delivered to or used by Applicant by the end of each water year (October I), shall revert to the water supplies of the District. Such reversion shall not entitle Applicant to any refund of payment made for such water. Water service provided by the District shall be limited to the amount of water available in priority at the original point of diversion of the District's applicable water right, and neither the District, nor those entitled to utilize the District's decrees, may call on any greater amount at new or alternate points of diversion. The District shall request the Colorado Division of Water Resources to estimate any conveyance losses between the original point and any alternate point, and such estimate shall be deducted from this amount in each case. Water service provided by the District for properties located within the Bluestone and Silt Water Conservancy Districts is provided pursuant to Agreements with said Districts. The Intergovernmental Agreement between the District and the Silt Water Conservancy District, dated January 25, 2001, is recorded as Reception No. 575691, Garfield County Clerk and Recorder's Office. The Intergovernmental Memorandum of Understanding between the District and the Bluestone Water Conservancy District, dated April 26, 200 I, is recorded as Reception No. 584840, Garfield County Clerk and Recorder's Office. Pursuant to Federal Law, the cultivation of marijuana is illegal. The U.S. Bureau of Reclamation has declared it unlawful to use Federal water facilities for the irrigation of marijuana or in furtherance of the cultivation of marijuana The West Divide Water Conservancy District provides augmentation water to contractees from Ruedi Reservoir and Green Mountain Reservoir, both of which are Federal water facilities managed by the Bureau of Reclamation. Therefore, the West Divide Water Conservancy District will not contract to provide augmentation water from Ruedi Reservoir or Green Mountain Reservoir for the irrigation of marijuana or in furtherance of the cultivation of marijuana Any such contracts shall be deemed null and void. The West Divide Water Conservancy District owns or possesses delivery contracts for other non-Federal water sources from which the District is able to provide augmentation water for the irrigation of marijuana or in furtherance of the cultivation of marijuana Should any contractee obtain a water allotment contract from the West Divide Water Conservancy District for the augmentation or irrigation of marijuana or in furtherance of the cultivation of marijuana, any and all such water shall be deemed to come from the non-Federal sources referenced above. 5. Alternate Point of Diversion and Plan of Augmentation: Decrees for alternate points of diversion of the District's water rights or storage water may be required in order for Applicant to use the water service contemplated hereunder. Obtaining such decree is the exclusive responsibility of Applicant. The District reserves the right to review and approve any conditions which may be attached to judicial approval of said alternate point of diversion as contemplated or necessary to serve Applicant's facilities or lands. Applicant acknowledges and agrees that it shall be solely responsible for the procedures and legal engineering costs necessary for any changes in water rights contemplated herein, and further agrees to indemnify the District from any costs or losses related thereto. Applicant is solely responsible for providing works and facilities necessary to obtain/divert the waters at said alternate point of diversion and deliver them to Applicant's intended beneficial use. Irrespective of the amount of water actually transferred to the Applicant's point of diversion, the Applicant shall make annual payments to the District based upon the amount of water allotted under this Contract. In the event the Applicant intends to apply for an alternate point of diversion and to develop an augmentation plan and institute legal proceedings for the approval of such augmentation plan to allow the Applicant to utilize the water allotted to Applicant hereunder, the 2 Applicant shall give the District written notice of such intent. In the event the Applicant develops and adjudicates its own augmentation plan to utilize the water allotted hereunder, Applicant shall not be obligated to pay any amount under Paragraph 19 below. In any event, the District shall have the right to approve or disapprove the Applicant's augmentation plan and the Applicant shall provide the District copies of such plan and of all pleadings and other papers filed with the water court in the adjudication thereof. 6. Contract Payment: Non-refundable, one time administrative charge, in the amount determined by the Board of Directors of the District from time to time, shall be submitted with the application for consideration by the District. Annual payment for the water service described herein shall be determined by the Board of Directors of the District. The initial annual payment shall be made in full, within thirty (30) days after the date of notice to the Applicant that the initial payment is due. Said notice will advise the Applicant, among other things, of the water delivery year to which the initial payment shall apply and the price which is applicable to that year. Annual payments for each year thereafter shall be due and payable by the Applicant on or before each January 1. If an annual payment is not made by the due date a flat $50 late fee will be assessed. Final written notice prior to cancellation will be sent certified mail, return receipt requested, to the Applicant at such address as may be designated by the Applicant in writing or set forth in this Contract or Application. Water use for any part of a water year shall require payment for the entire water year. Nothing herein shall be construed so as to prevent the District from adjusting the annual rate in its sole discretion for future years only. If payment is not made within fifteen ( 15) days after the date of said written notice, Applicant shall at District's sole option have no further right, title or interest under this Contract without further notice, and delivery may be immediately curtailed. The allotment of water, as herein made, may be transferred, leased, or otherwise disposed of at the discretion of the Board of Directors of the District. Upon cancellation of this water allotment Contract with the District, the District shall notify the Division of Water Resources offices in Denver and Glenwood Springs. The Division of Water Resources may then order cessation of all water use. 7. Additional Fees and Costs: Applicant agrees to defray any expenses incurred by the District in connection with the allotment of water rights hereunder, including, but not limited to, reimbursement of legal and engineering costs incurred in connection with any water rights and adjudication necessary to allow Applicant's use of such allotted water rights. 8. Assignment: This Contract shall not inure to the benefit of the heirs, successors or assigns of Applicant, without the prior written consent of the District's Board of Directors. Any assignment of Applicant's rights under this Contract shall be subject to, and must comply with, such requirements as the District may hereafter adopt regarding assignment of Contract rights and the assumption of Contract obligations by assignees and successors. Nothing herein shall prevent successors to a portion of Applicant's property from applying to the District for individual and separate allotment Contracts. No assignment shall be recognized by the District except upon completion and filing of proper forms for assignment and change of ownership. In the event the water allotted pursuant to this Contract is to be used for the benefit ofland which is now or will subsequently be subdivided or held in separate ownership, the Applicant may only assign the Applicant's rights hereunder to: I) No more than three separate owners all of whom shall be party to a well sharing agreement satisfactory to the District; or 2) A homeowners association, water district, water and sanitation district or other special district properly organized and existing under the laws of the State of Colorado, and then, only if such parties, association or special district establishes to the satisfaction of the District that it has the ability and authority to perform the Applicant's obligations under this Contract. In no event shall the owner of a portion, but less than all, of the Applicant's property to be served under this 3 Contract have any rights hereunder, except as such rights may exist pursuant to a well sharing agreement or through a homeowners association or special district as provided above. Upon the sale of the real property to which this Contract pertains, Applicant shall make buyer aware of this Contract and proper forms for assignment and change of ownership must be completed. 9. Other Rules: Applicant shall be bound by the provisions of the Water Conservancy Act of Colorado; by the rules and regulations of the Board of Directors of the District; and all amendments thereof and supplements thereto and by all other applicable law. I 0. Operation and Maintenance Agreement: Applicant shall enter into an "Operation and Maintenance Agreement" with the District under terms and conditions determined by the board of Directors of the District, if and when, the Board of said District determines in its sole discretion that such an agreement is required. Said agreement may contain, but shall not be limited to, provisions for additional annual monetary consideration for extension of District delivery services and for additional administration, operation, and maintenance costs; or for other costs to the District which may arise through services made available to the Applicant. 11. Change of Use: The District reserves the exclusive right to review, re-approve or disapprove any proposed change in use of the water allotted hereunder. Any use other than that set forth herein or any lease or sale of the water or water rights allotted hereunder without the prior written approval of the District shall be deemed to be a material breach of this Contract. 12. Use and Place of Use: Applicant agrees to use the water in the manner and on the property described in the documents submitted to the District at the time this Contract is executed, or in any operation and maintenance agreement provided by Applicant. Any use other than as set forth thereon or any lease or sale of the water or water rights herein, other than as permitted in paragraph 8 above, shall be deemed to be a material breach of this agreement. 13. Title: It is understood and agreed that nothing herein shall be interpreted to give the Applicant any equitable or legal fee title interest in or to any water or water rights referred to herein. 14. Conservation: Applicant shall use commonly accepted conservation practices with respect to the water and water rights herein, and hereby agrees to be bound by any conservation plan adopted hereafter by the District for use of District owned or controlled water or water rights. 15. Restrictions: Applicant shall restrict actual diversions to not exceed the contract amount for ordinary household purposes, the watering of domestic livestock, fire protection, and the irrigation of lawn and garden as specified in the Application. Applicant shall also comply with all restrictions and limitations set forth in the well permit obtained from the Colorado Division of Water Resources. Watering of livestock shall be restricted to Applicant's domestic animals not to be used for commercial purposes unless Applicant obtains approval from the Colorado Division of Water Resources for commercial use/livestock watering, provided that in no event shall actual diversions exceed the amount of water provided by this Contract. Violation of this paragraph 15 shall be deemed to be a material breach of this Contract. 16. Well Permit: If Applicant intends to divert through a well, then Applicant must provide to District a copy of 4 Applicant's valid well permit before District is obligated to deliver any water hereunder. 17. Measuring Device or Meter: Applicant agrees to provide, at its own expense, a measuring device deemed acceptable by the District's Engineer after consultation, or a totalizing flow meter with remote readout to continuously and accurately measure at all times all water diverted pursuant to the terms of Applicant's water right and the terms of this Contract. Applicant agrees to provide accurate readings from such device or meter to District upon District's request. Applicant acknowledges that failure to comply with this paragraph could result in legal action to terminate Applicant's diversion of water by the State of Colorado Division of Water Resources. By signing this Contract, Applicant hereby specifically allows District, through its authorized agent, to enter upon Applicant's property during ordinary business hours for the purposes of determining Applicant's actual use of water. 18. Representations: By executing this Contract, Applicant agrees that it is not relying on any legal or engineering advice that Applicant may believe has been received from the District. Applicant further acknowledges that it has obtained all necessary legal and engineering advice from Applicant's own sources other than the District. Applicant further acknowledges that the District makes no guarantees, warranties, or assurances whatsoever about the quantity or quality of water available pursuant to this Contract. Should the District be unable to provide the water contracted for herein, no damages may be assessed against the District, nor may Applicant obtain a refund from the District. 19. Costs of Water Court Filing and Augmentation Plan: Should the District, in its own discretion, choose to include Applicant's Contract herein in a water court filing for alternate point of diversion or plan of augmentation, then Applicant hereby agrees to pay to the District, when assessed, an additional fee representing the District's actual and reasonable costs and fees for Applicant's share of the proceedings. Applicant shall be assessed a pro-rata share of the total cost incurred by the District in preparing, filing and pursuing to decree the water court case. The pro-rata share shall be calculated by dividing such total cost by the number of contractees included in the filing. To the extent that the District is caused additional costs because of objection filed specifically due to the inclusion of Applicant's Contract in the filing, such additional costs may be charged specifically to Applicant and not shared on a pro-rata basis by all contractees. 20. Binding Agreement: This agreement shall not be complete nor binding upon the District unless attached hereto is the form entitled "Application to Lease Water From West Divide Water Conservancy District" fully completed by Applicant and approved by the District's engineer. Said attachments shall by this reference thereto be incorporated into the terms of this agreement. All correspondence from the District to Applicant referring to or relating to this agreement is by this reference incorporated into this agreement as further terms and conditions of this agreement. 21. Warning: IT IS THE SOLE RESPONSIBILITY OF THE APPLICANT TO OBTAIN A VALID WELL PERMIT OR OTHER WATER RIGHT IN ORDER TO DIVERT WATER, INCLUDING THE WATER ACQUIRED UNDER THIS CONTRACT. IT IS THE CONTINUING DUTY OF THE APPLICANT TO MAINTAIN THE VALIDITY OF THE WELL PERMIT OR WATER RIGHT INCLUDING FILING FOR EXTENSIONS OF PERMITS, FILING WELL COMPLETION REPORTS, FILING ST A TEMENTS OF BENEFICIAL USE, OR OTHERWISE LAWFULLY APPL YING THE WATER TO BENEFICIAL USE ON A REGULAR BASIS WITHOUT WASTE. 22. AREA B. CONTRACTS: IF APPLICANTS WELL OR OTHER WATER RIGHT THAT IS THE SUBJECT OF THIS CONTRACT IS LOCATED OUTSIDE "AREA A" AS DESIGNATED BY THE DISTRICT, THEN THIS PARAGRAPH APPLIES: THE AUGMENTATION WATER PROVIDED BY THE DISTRICT UNDER THIS CONTRACT MAY ONLY PROTECT APPLICANT"S WATER RIGHT FROM A CALL ON THE COLORADO RIVER AND MAY NOT PROTECT APPLICANT FROM A CALL FROM ANY OTHER 5 SENIOR RIGHT. NO REPRESENTATION OTHERWISE IS MADE BY THE DISTRICT. IF THIS IS A CONCERN TO APPLICANT, THIS CONTRACT MAY BE RESCINDED UPON WRITTEN NOT ICE DELIVERED TO THE DISTRICT BY THE APP LICANT WITHIN THE NEXT 30 DAYS FOLLOWING THE AFFIXING OF SIGNATURES ON THIS CONTRACT IN WHICH EVENT ALL SUMS PAID BY APPLICANT FOR THIS CONTRACT SHALL BE IMMEDIATELY REFUNDED TO APPLICANT. MM Mf W6,L~ ,~ C ~ilk_ mat1a.5Ee... Applicant Appli cant ORDER After a hearin g by the Board of Directors of the West Divide Water Co nservancy District on the App lication, it is hereby ORDERED tha t said Appli cation be granted and this Contract shall be and is accepted by the District . 8 ~ESTDIV ID~k= Pres ident ATTEST: Date This Contract includes and is subject to the tc.rms and conditi ons of the fo llowing documents whi ch must accompany this Contract: 1. Map showing location of point of diversion (use map provided) 2. Appli cation and Data F onn fully completed and signed The printed portions of this form, except dlO'e rentlated additions or d eletions, have been a pproved and adopted by the West Divide Water Cons,,rvancy District. Form: WDWCD 01 -01-08 CONTRACT. 6 ZANCANELLA AND ASSOCIATES, INC LETTER !" #$ %&'('$ #$ %&'(')* ! " # $% #& & ' ( & )& * ))( "++, #& "++,) ) & ! & ) ) *&* ( ( & & -. ) ( ) ) #& ( * & ! (( *& ) ' & ( " & ! & & *' ./0 ( ! ( $10 ' #& * ))*' & && " ! , ! & 2 3 .$4 ( 54510#& " ! ) ) ! * ( ) ( & "& & ) ) ) * ' )) ( & 6 & & & ' ) ! ( & ! " "& * ' ! & & ! " $ ! " - ' & ) ' * )) ( & * & (( ' )) ( ! " $ #& * & 6 $78(/ $#*&)/& 4 " (& &9 &*0 $ , ! ;;;~~~;;;;;~'?~ 2: Z°'ANCANELIA ANO ASSOCIATES', INC. E°'NG"INEEAtNG" CONSULTANTS' ~ 7:£eloe~.-.04n!X\.t.,,lfot , ........-,~, ... ,,. ) +,--". /01"/2. + 3 4 ! ! " $ ! " - +, AIIStructure~(l) 1,,,,ol{,;..dd,,dtu~k, Stn,c1u1•Wei DEVERWELLN01 ) ••• (~m,•1 In IJn • Arow StfUCl-wll~CO"!ffl'll)O'j') .. """'""'~•d,(A WA!W S<>ul<• -Gl!OLfllOlo'tATfij (0(0111,00 RMR Au.ocPe,,.<t~l07;1 ,8-!JH;; Anoe Case No ~18'l W16'1!, W356! N1~1 • OEVER WELL NO 2 WOIO ~ 3!05081 : m:•• .,1,..-kt,~\1,,_..,,.,.. . .,,~<0"!"""°"'"' """"''°",..,.,.<k\A W1<«Sourc. • GROI.JM:lri,,ATE'!,COlOAAOO RNEJI. !'>ln,,<1u,~WdOI.VEl!WlLlHOl ) ••• Cvfrc•~-.,..1J1e=At~¥tS1n,c11,r•wll·•=1empo,l'r "'-'i-onrwco<dl(A) .,...l'l~rSourtt C,ftCIONOWATtltCOlOI\.AOORIVUI 4•-Poe•'IWII ~Hl'i-,&.:l5.t-' AHOC C ... No• w:J184, W16'19. W3S69 UX.uon Arone,.-c'll tozrd ~ 7:£eloe~.-.04n!X\.t.,,lfot , ........-,~, ... ,,. 15 /, / )) / 9)) & ( * & * ! " $1$4 $4#& * ! ) & )) * $$5.( ' *& )(& * #& * * )) ( .& )) ($%)#& * ** ))* ! ($- 1( )) & * ! ! ' ! ( $$8. 0 $&* ! " $* & ) ) ",++, ) ) &* ( ) ) #& * ' ) ! * ( & & ! :( 1 * 8:& (* * ) ! '/ 9),) $ #& ( &*' ** ' #& ** ! ! &*0 ~ 7:z.e,,,c~.-.0~ ..... lfot. ~COf'IM'"""" 15 /, / &) August 20 , 20 19 Mark Gou ld 68 74 Hwy. 82 Glenwo od S pri n gs, Co. 81601 ATTN: Mark On 8/19/19 , a well test was conducted on the west well on th e Dever Pro pert y . The following info1mat ion was obtaine d; Well Dep -------------------------------------150 'a pp rox. Casi ng Size------------------------------------5" Standin g wa ter leve l--------------------------116.75 ' To tal test time ----------------------------------2 .5 Hours Drawdown to ----------------------------------132.0 ' Produc tion is ----------------------------------18 GPM This tes t was cond ucted with the existing pump. The well water leve l recovered back to 12 1.4 in 50 M inutes . If yo u have any ques tions pl ease call me, Raun Samu e lso n at 9 70- 945 -63 09 . Sincere ly ; Raun E Samuelson Sanm elson P um p Co . P.O . Box 297 • Glenwood Springs , CO 81602 • (970) 945-6309 • Fax (970) 947-9448 Water Systems • Sales, Service & lnstallat,on ~ 7:z.e,,,c~.-.0~ ..... lfot . ~COf'IM'"""" 15 /, / ') July '27 . _022 Mark Gould 6874 Hwy . 82 Glem,o d prings, o . 81601 ATfN: \.1ar On 8/19/19, a well test" was condu ted on the west well De, er# I. Th following information was obtained; Well Depth-------------------------------150'app asing izc ----------------------------------5" landing water level-------------------------I 2"' .o· Total te t time--------------------------------4H ur Drawdown LO --------------------------------141.55" Produ tion is --------------------------------15 PM Thi te st wa ondu led "ith the cxj ting pump . The well aler level re covered ba k to 128.0' m 60 1\llinut s. If ou have an_ que ti o n: please cal me. Raun amuel on at 970- 94 -6 309 . Raun L 'amuel on amuelson Pump o . P.O. Box 297 • Glenwood Spr ngs. CO 81602 • (970) 945 6309 • Fax (970) 947-9448 Water Systems • Soles Serv1c & fl s a at o ~ 7:z.e,,,c~.-.0~ ..... lfot . ~COf'IM'"""" 15 /, / ) 0 Dever Well #1 Drawdown 0.00 5.00 10.00 ~ 15.00 j is 20.00 25.00 30.00 +---------------~---------------~--------------~ 10 100 1000 Time since pumping started (min, logarthmic sca le) _._ Drawdown -----Available Drawdown Dever Well #1 Recovery 10 100 1000 t/t'(IQ8arithmicsca le) ~ 7:z.e,,,c~.-.0~ ..... lfot . ~COf'IM'"""" 15 /, / $) #& )) '/ 9),) * ) ( & * ! " -$4 #& * ! ) & )) * $ 88( ' *& )(& * #& * * )) ( 8& )) ( )#& * ** ! ($ 45( .-( ( **#& ! ( ))(! &* * ! $ 8 ' *& )(& ! " - ) ! & ( & ) ; & * * ))5451(#&* < & * )) ! 84)1( $ (*' < ' ) & )) * & & * )) )& ! " - ' & ' ) ! " $*&&)) $.)#& ( (( *& ' & ( ( ) ~ 7:z.e,,,c~.-.0~ ..... lfot. ~COf'IM'"""" 15 /, / ) $ //.65 7 $88 4 !4 !334 + 9) !4 /: ; 4 !<4 = + > 4:((((((((((((((((((((((((((((((((((((( ? " ! @ (((((((((((((((((((((((((((((((((((($'A 4 4 (((((((((((((((((((((((((( &&? /4 4 !44 ; ((((((((((((((((((((((((((((((((((&B! > 4(((((((((((((((((((((((((((((((((( $? 34 !(((((((((((((((((((((((((((((((((( 4 4: 5 /: !4 !4 !334 4: !4 ; /: 4 3 < 374 & ' 5 4 !2: C !4 ! ! 3 ; 0 ; ! 4$ (&'() 3 = 0 , ; ! ; ! ; " ~ 7:z.e,,,c~.-.0~ ..... lfot. ~COf'IM'"""" 15 /, / ) ! " $ ! * '/ 9),) ( ) ( ( & * ))* )) #& * ** ))* ! ( $8$..' *& )(& * 1( )) & * ! ! ' ! ( $% ! " - ! * '/ 9),) #& * ** ))* ! ($ 451( )) & * ! ! ' ! ( $ 8. #& * &* ! ( ! #&* & ! * ( & & )) ~ 7:z.e,,,c~.-.0~ ..... lfot. ~COf'IM'"""" )+/,0D1-2/E ) 1 (* < &*# ' $( ! " $=(& ) ,& # /( ( ) ' ! " $ # ' &*& ,& # //( ,! &&( ! " - #& ' &*& ,+ & / ,+ ,+> ,+? ! 1 = ! ( * ' & #& * &' ) ' *& ) ) @* ! & &* ! ! (/1 ) ! /*) & * :( ( ) ) ' ! & / ' )& ~ 7:z.e,,,c~.-.0~ ..... lfot. ~COf'IM'"""" )+/,0D1-2/E ) ! "#$$ " " %%&$&$&$ $ #" ' $ (( % ! $ &$') &$ " $$% & %% $ $ * " & & ( # $+( $(, $( -& (, $( $ %&&$ & & & "$ (# $ #+ (, $( $ $# ( $ "% & &&$$ Tabl e 1: S ummary of Re s ul ts fo r 2022/06 /2 2 sampl i n g of Deve r Well 1 for MMM E WG . Analyte Re sult Units Thr e shold Th e shold Authority Statu s Arsen i c, tot a l recoverab l e < 0.0005 mg/L 0 .01 MC L, Reg 11 PASS Cadm i um, tota l recoverab l e < 0 .008 mg/L 0 .0005 MC L, Reg 11 PASS Fluori de 0.1 6 mg/L 4 .0 MC L, Reg 11 PASS Ni t rate as N, d i sso l ved 0 .653 mg/L 1 0 .0 MC L, Reg 11 PASS Ni t ra t e/Ni t r i te as N, disso l ved 0 .653 mg/L 1 0 .0 MCL, Reg 11 PASS Ni t r i te as N, d i sso l ved < 0.01 mg/L 1.0 MC L, Reg 11 PASS Ura nium, tot a l recoverab l e 0.0 0274 mg/L 0 .03 MCL, Reg 11 PASS Gross Al pha 1 2 . 0 pCi/L 1 5 .0 MC L, Reg 11 PASS Gross Be t a 3 .2 pCi/L 1 5 .0 MCL, Reg 11, E .P.A. PASS Ch l oride 407 .0 mg/L 250 .0 SMC L, Reg 11 FA IL Copper , t ot a l recoverabl e < 0.01 mg/L 1.0 SMC L, Reg 11 OK Corros i v i ty (calc .) 0 .9 SI Un it > 0 SMC L, Reg 11 OK I ron, tot a l recoverabl e 0.065 mg/L 0 . 3 SMC L, Reg 11 OK Lead , tota l recoverabl e 0 .00011 mg/L 0 .0 1 5 Reg 11.26 OK Manga nese, t ota l recoverabl e < 0 .01 mg/L 0 .05 SMC L, Reg 11 OK pH ( Fiel d) 7.8 #N/A 6 .5 to 8.5 SMC L, Reg 11 PASS Residue, Fi lterab l e (TD S) @180 C 1 ,230 .0 mg/L 50 0 .0 SMC L, Reg 11 FA IL Su lfate 56. 5 mg/L 250 .0 SMC L, Reg 11 OK Zinc , tot a l recoverabl e 0.03 1 mg/L 5 .0 SMC L, Reg 11 OK Conductivity @25C 1 ,660 .0 um hos/cm 2 ,100 .0 North Dakot a SU OK Bicarbon ate as CaC03 172.0 mg/L n /a see Tot a l Al ka lini t y n/a Carbonat e as CaC03 < 2 mg/L n/a see Tota l Al ka linity n/a Hydroxide as CaC03 < 2 mg/L n /a see To t a l Al kali ni t y n/a Tot a l Al kalinity 172.0 mg/L graduated U.S.G.S . OK Ca l cium, disso l ved 176.0 mg/L 1 ,00 0 .0 W.H .O. OK Mag nes i um , d i sso l ved 15 .5 mg/L 1 25 .0 North Dakot a SU OK Hard ness as CaC03 (disso l ved) 503.0 mg/L graduated No r th Da kota SU OK Sod ium Adsorption Ratio i n Water 2. 2 2 .0 Penn State Univ . FA IL Sod ium, dissol ved 111.0 mg/L 100 .0 No r th Dakot a SU FA IL Tot a l Co liform PA absent PA absent n/a PASS prepared for: prepared by: VJH MMM E WG ~ 7:z.e,,,c~.-.0~ ..... lfot . ~COf'IM'"""" )+/,0D1-2/E ) . ! "#$$ " " %%&$&$&$ $ #" / $ (( % ! $ &$') &$ " $$% & %% $ $ ) " & & ( # $+( $(, $( -& (, $( $ %&&$ & & & "$ (# $ #+ (, $( $ $# ( $ "% & &&$$ Table 2 : Summary of Resu l ts for 2022/06/22 samp ling of Dever Well 3 for MMME WG. Analyte Arsenic, total recoverable Cadmium, total recoverable Fluoride Nitrate as N, dissolved Nitrate/Nitrite as N, dissolved Nitrite as N, di ssolved Uranium, total recoverable Gross Alpha Gross Be ta Chloride Copper, total recoverable CorrosivJty (calc.) Iron, total recoverable Lead, total recoverable Manganese, 'total recoverable pH (Fiel d) Residue, Filterable (TOS) @180C Sulfate Zinc, total recoverable Conductivity @25C Bicarbonate as CaCO3 Carbonate as CaCO3 Hydroxide as CaCO3 Total Alkalinity Calcium, dissolved Magnesiu"', dissolved Hardness as CaCO3 (dissolved) sodium Adsorption Rat io i n 14ate r Sodium , dissolved Total Coliform PA pr-e~ared for: IN'IE WG Result < 0.001 < 0.016 0 .86 0.462 0.462 < 0 .01 0.0095 1. 3 11.0 1,630.0 < 0.02 0.a 0.263 0.08305 < 8.82 7 .8 3,418.8 456.0 0.889 5,750 .0 308.0 < 2 ( 2 300.0 106.0 55 .2 492.0 19.0 960.8 absent Units mg/L mg/L mg/L mg/L mg/L mg/L mg/L pCi/L pCi/L mg/L mg/L SI Unit mg/L mg/L mg/L #N/A mg/L mg/L mg/L urihos/cr.i mg/L mg/L mg/L mg/L mg/L mg/L mg/L mg/L PA Threshold 0.81 0.0005 4.0 10.0 10 .0 1.0 8.03 15 .0 lS .0 258.0 1 .0 ) 0 0.3 8.015 8.85 6 .5 to 8.5 500.8 250.8 5.0 2,100.8 n/a n/a n/a groduoted 1,000.8 125.8 groduoted 2 .0 100.8 absent ~ 7:z.e,,,c~.-.0~ ..... lfot . ~COf'IM'"""" Thesho l d Authority MCL, Reg 11 MCL, Reg 11 MCL, Reg 11 MCL, Reg 11 MCL, Reg 11 MCL, Reg 11 MCL, Reg 11 MCL, Reg 11 MCL, Reg 11, E. P .A. SMCl, Reg 11 SMCL, Reg 11 SMCL, Reg 11 SMCl, Reg 11 Reg 11.26 SMCl, Reg 11 SMCL, Reg 11 SMCL, Reg 11 SMCL, Reg 11 Sr.CL, Reg 11 North Da kota SU see Total Alkalinity see Total Alkalinity see Total Alkalinity u.s.G.s . W.H.O. No r th Dakota SU North Dakota SU Penn State Univ. North Dakota SU n/a Status PASS PASS PASS PASS PASS PASS PASS PASS PASS FAIL OK OK OK OK OK PASS FAIL FAIL OK FAIL n/a n/a n/a OK OK OK OK FAIL FA[L PASS prepared by : VJH 7/26/2022 & 1550E.>"."-1 2. )) #& )) & ! " $ -*' ' ( * ! & ) ) #& <( *&&& * > & & <( ( *: && (& & ' )) ( ', ! " ! &' ' *& * & ! ' & " ( ' A(( & : *&) * ! #& * & ! ' )) ))& ) * ! & ( *& B #& 1C D9 =(( 45 48..5 D45 -544D0 2 45 48.$.- EE : D $ $$ 1! D */) ,=%$ $ ~ 7:£eloe~.-.04n!X\.t.,,lfot , ........-,~, ... ,,. Form No . GWS-11 08/2016 [ E~it ] COLORADO DIVISION OF WATER RESOURCES DEPARTMENT OF NATURAL RESOURCES 1313 Sherman St., Ste 821, Denver CO 80203 For Office Use Only (303) 866-3581 dw .. erinltsonline stateico;us Received ~---....LC-H-A_N_G_E-IN_O_W=N-"E~R~N~A~M~E;,;;,;.;/M~A~IL~IN~G~A~D ..... D_R_E_S_S ___ .........i April 11 , 2 022 PRIOR TO COMPLETING THIS FORM, SEE INSTRUCTIONS ON REVERSE SIDE INCOMPLETE, POOR QUALITY, OR ILLEGIBLE FORMS CANNOT BE PROCESSED AND WILL BE RETURNED Ni!M, ftddressaj:1¢ 12h06, f1Qrub@tof per,on daltnlngowfiefsnip of,ffig we ll perrijtt: Name(s): MMME WG LLC Mailing Address: _P--'_-'"o ..;... _B..;..ox_. _13 .... o_,.._..._..;....;.. ________________________ __ City, St. Zip:.Glenwood Springs, CO81602 Phone: ~). 945 ~ 7291 . Well Permit Number: ... 8~43_5_3_-F_==-......... -Receipt Number:'"'"'••• 3_6..;..· 9_3_74_1_A _____ Case Number (optional);._•----"--------..... WELL LOCATION: County:_G ___ a;_rfi_1e .... ld ___ ,,__ _____ ~---------Well Name or# (optional): _D_e_v_e_r _W_e_ll_N_o_. _1 _________ _ 49893 Highway 6 & 24 Glenwood Springs co 81601 Street Address at Well Location City State Zip D Check if we ll add ress is same as owner's mailing address SW 1/4 of the .!::!E_ 1/4, Sec. _1 __ , Township §.:.Q_ 0 N. or[!] S., Range 90 .0 0 E. or[!]W.,..;;S;.;.;ix.;;;th ......... _______ ____ P.M . Distance from Section Lines: ....._....._ __ Ft. from D N. orO S. Line, _______ .Ft. from DE. or Ow. Line . Subdivision Name (if applicable):Dever Subdivision Exemption , Lot _B __ , Block __ , F ili ng /Unit ____ ---! NOTE : If changing/correcting the permitted location of a well, use Form No. GWS-42. I (we) claim and say that I am (we are) the owner(s) of the well permit described above , know the contents of the statements made herein, and state tha t they are true to my (our) knowledgf:i'. •. T _· -filing is made pursuant to C.R.S. 37-90-143. , , Please printthe Signer's Name & Title Date Mark C. Gould, Manager It is the responsibility of the new owner of this well permit to complete and sign this form . If an agent is signing or entering information, please see instructions. Please allow 4 to 6 weeks for processing of this form . Thereafter, you can view or print the accepted document at: h~p;l~.dwr,state;co .usJWellP!;!tmitSear ch Signature of bWR staff indicates acceptance as a Change in Owner Name arid/or Mailing Address . For Staff Use Only Alex Teitz 6/15/22 Date Form No. GWS-11 08/2016 COLORADO DIVISION OF WATER RESOURCES DEPARTMENT OF NATURAL RESOURCES 1313 Sherman St., Ste 821, Denver CO 80203 (303) 866-3581 dwrpermitsonllne state.co.us For Office Use Only CHANGE IN OWNER NAME/MAILING ADDRESS Received -------------------------April 11, 2022 PRIOR TO COMPLETING THIS FORM, SEE INSTRUCTIONS ON REVERSE SIDE INCOMPLETE, POOR QUALITY, OR ILLEGIBLE FORMS CANNOT BE PROCESSED AND WILL BE RETURNED Name(s): MMME WG, LLC Mailing Address: _P_.-0-'-. ;;:.Bo;;.;xc..c..13;;..;0;._ ______________________ _ City, St. Zip: Glenwood Sorinas. CO 81602 Email: mark@gouldconstruction.com Well Permit Number: _84_3_5_5_-F ______ Receipt Number:,_3-6_9_37'-4'-2 ______ Case Number (optional): _____ _ WELL LOCATION: County: _G_a __ rfi-1e'-ld"-------------Well Name or# (optional): _D_e_v_e_r _W_e_ll __ N"'"'o_. _2 _______ _ 49893 Highway 6 & 24 Glenwood Springs co 81601 Street Address at Well Location City State Zip 0 Check if well address is same as owner's mailing address ~ 1/4 of the NW 1/4, Sec. _1 __ , Township .§.:_Q_ D N. or[!] S., Range 90.0 DE. or[!]W., _s ______ _ P.M, Distance from Section Lines: ____ Ft. from D N. or D S. Line, _____ Ft. from DE. or D W. Line. Subdivision Name (if applicable): Dever Subdivision Exemoton , Lot A__, Block __ , Filing/Unit ____ -1 NOTE: If changing/correcting the permitted location of a well, use Form No. GWS-42. I (we) claim and say that I am (we are) the owner(s) of and state that they are true to my (our) knowledge. Th II permit described above, know the contents of the statements made herein, is made pursuant to C.R.S. 37-90-143. ease print the Signer's Name & Title Date Mark C. Gould. Manager MMMEWG, LLC It is the responsibility of the new owner of this well permit to complete and sign this form. If an agent is signing or entering information, please see instructions. Please allow 4 to 6 weeks for pro,ce1,sir1g of this form. Thereafter, you can view or print the accepted document at: Signature of DWR staff indicates acceptance as a Change in Owner Name and/or Mailing Address. For Staff Use Only Alex Teitz 6/15/22 Staff Signature Date Form No. GWS-11 08/2016 COLORADO DIVISION OF WATER RESOURCES DEPARTMENT OF NATURAL RESOURCES 1313 Sherman St., Ste 821, Denver CO 80203 (303) 866-3581 d ermlt onllne state.co.us CHANGE IN OWNER NAME/MAILING ADDRESS PRIOR TO COMPLETING THIS FORM, SEE INSTRUCTIONS ON REVERSE SIDE INCOMPLETE, POOR QUALITY, OR ILLEGIBLE FORMS CANNOT BE PROCESSED AND WILL BE RETURNED Name(s): MMME WG. LLC Mailing Address: _P_._o_. _B_ox_13_0 _______________________ _ City, St. Zip: Glenwood Springs, CO 81602 Email: mark@aouldconstruction.com For Office Use Only Received April 11, 2022 Well Permit Number: _8_43_5_4_-F ______ Receipt Number:,_3_6_93_7_4_1_8 _____ Case Number (optional):, _____ _ WELL LOCATION: County: _G_a_rfi_1e_ld ___________ Well Name or# (optional): _D_e_v_e_r W_e_ll_N_o_. _3 _______ _ 49893 Highway 6 & 24 Glenwood Springs co 81601 Street Address at Well Location City State Zip D Check if well address is same as owner's mailing address ~ 1/4 of the~ 1/4, Sec. _1 __ , Township~ D N. or[!] S., Range 90.0 DE. or[!]W., -S_ix_th"'-------P.M. Distance from Section Lines: Ft. from D N. or D S. Line, ----_____ Ft. from DE. or D W. Line. Subdivision Name (if applicable): Dever Subdivision Exemption , Lot~. Block __ , Filing/Unit ____ -; NOTE: If changing/correcting the permitted location of a well, use Form No. GWS-42. I (we) claim and say that I am (we are) the owner(s) of the well permit described above, know the contents of the statements made herein, and state that they are true to my (our owledge. is made pursuant to C.R.S. 37-90-143. ase print the Signer's Name & Title Date Mark C. Gould. Manaaer MMMEWG, LLC It is the responsibility of the new owner of this well permit to complete and sign this form. If an agent is signing or entering information, please see instructions. Please allow 4 to 6 weeks for processing of this form. Thereafter, you can view or print the accepted document at: earc Signature of DWR staff indicates acceptance as a Change in Owner Name and/or Mailing Address. For Staff Use Only Alex Teitz 6/15/22 Staff Signature Date CDOT ACCESS PERMIT DOCUMENTS Mr. Brian Killian Colorado Department of Transportation Region 3 -Traffic and Safety, Permit Unit Manager 222 South 6th Street, Room 100 Grand Junction, Colorado 81501 January 11th, 20221 RE: COOT State Highway 6 & 24 Access Permit Change in Use Request Permit #320017 MMME WG, LLC -Glenwood Springs, Colorado Sopris Engineering, LLC #19137 Dear Mr. Killian, The following letter is a request for an Access Permit for change in use of the current access permit to 49893 Highway 6 & 24, in Glenwood Springs, Colorado. The existing access permit is for use of a 76 single family homes under permit number 320017 with amendment, granted on March 10, 2021 . After corresponding with the City of Glenwood Springs and Garfield County with the local Land Use Code, the developer has changed the use of the property to 134,400 square feet of storage units with one existing single-family home and one new single-family home for employee housing. Sopris Engineering has completed a traffic analysis using the ITE, Trip Generation Manual, 9 th Edition. The existing access permit for the development, is for 75 single family homes and 1 existing single-family home. Resulting in 59 Peak AM trips and 78 Peak PM trips. The new peak hour trips can be seen in the table below. Code Name Weekday Peak AM Weekday Peak PM 210 Single-Family Detached Housing 0.77/Dwelling 1.02/Dwelling 2 1.54 2.04 151 Mini-Warehouse 0.28/1000 SF 0.29/1000 SF 134,400 Square Feet 37.63 38 .97 Total 39.17 41.01 *Code 210: Single-family detached housing includes all single-family detached homes on individual lots. A typical site surveyed is a suburban subdivision . *Code 151: A mini warehouse is a building in which a number of storage units or vaults are rented for the storage of goods. They are typically referred to as "self-storage" facilities. Each unit is physically separated from other units, and access is usually provided through an overhead door or other common access point. After reviewing the exiting permit and the proposed change of use, it is in our opinion that the traffic impact will decrease substantially. Let me know if you want to issue a new permit or an amendment to the existing access permit If you have any questions or need any additional information, please let me know. Sincerely, SOPRIS ENGINEERING, LLC J';W Yancy Nichol, PE Attached: Civil Site Plan I 502 Main Street • Suite A3 • Carbondale, CO 81623 • (970) 704-0311 • Fax (970) 704-0313 SOPRIS ENGINEERING • llC civil consultants R3 Traffic, Access Unit, 222 S. Sixth St, Rm 100, Grand Junction, Colorado 81501 PH (970) 683-6284 www.codot.gov Region 3 Traffic Section, Access Unit 222 S. Sixth St, Rm 100 Grand Junction, CO 81501 PH (970) 683-6284 FAX (970) 683-6290 March 8, 2022 MMME WG, LLC 6874 Hwy 82 Glenwood Springs, Colorado 81623 Re: Extension of Access Permit No. 320017, located in Garfield County on Highway 070A near Mile Reference Pt. 113.147 Left Dear Permittee, Your request for a one-year extension of the above-referenced State Highway Access Permit has been approved. This permit, which was originally due to expire on 04/28/2022, has been extended to 04/28/2023. This is the second and final extension of the permit. Subsection 2.3 (11) (d) of the State Highway Access Code, 2 CCR 601-1 states, in part: “. . . No more than two (2) one-year extensions may be granted under any circumstances. If the access is not under construction within three years from the original date of issue, the permit will be considered expired . . ." A copy of this letter must be attached to the permit and be readily available at the job site when performing work. If you do not have a Notice to Proceed (NTP), please note that CDOT will still need to review construction plans, signing and striping plans, traffic control plans, and Certificate of Liability insurance (naming CDOT as an additional insured) prior to construction. Please note that all the original terms and conditions of each permit still apply. If there are any further concerns or questions, please feel free to contact this office at the address or phone number listed above. Sincerely, Kandis Aggen Region 3 Asst. Access Manager Cc: File COLORADO Departmentof Transportation Region 3 Traffic, Access Unit 222 S 6th St, Rm 100 Grand Junction, CO 81501 PH 970-683-6284 FAX 970-683-6290 <<< E-mailed>>> February 10, 2022 MMME WG, LLC 6874 Hwy 82 Glenwood Springs, Colorado 81623 RE: State Highway Access Permit No. 320017 located in Garfield County on Highway 070A near Mile Reference Pt. 113.147 Left Dear Permittee, Section 2.4(5) of the State Highway Access Code states: “When necessary to amend a permit, and the Permittee is agreeable and waives the right to an administrative hearing on the amendment, a letter detailing the amendment with reasons for the amendment shall be prepared. The letter of amendment requires the approval of the issuing authority, the Department, and the Permittee.” The access permit referenced above is hereby amended to include, change, add, or omit the following: Omit the following Land Use and Volume (from the previous amendment): 210 – Single Family Home – 76 homes 78 DHV Add the following Land Use and Volume: 210 – Single-Family Detached – 2 homes 2 DHV 151 – Mini-Warehouse 134,000 Sq. Ft. 39 DHV Total 41 DHV The undersigned parties agree to the permit amendment as described above. The Permittee waives the right to an administrative hearing on the amendment. There are no other forms or verbal agreement. This form and the permit documents constitute the complete agreement. Permittee/Property Owner (Print Name): Title: Permittee/Property Owner Signature: Date: Co-Permittee (Print Name): Title: Co-Permittee Signature: Date: CDOT Authorized Representative Print Name: Title: CDOT Authorized Representative Signature: Date: $ # " $ ! -DocuSigned by: 1 ~ tbtJi -1B511C8150214E4 ... -DocuSigned by: Ob-~~ B1CF3B58529F4D5 ... CO L ORA D O Depa.rtrnentof Transportation R3 Traffic Section, Access Unit 222 S 6th St, Rm 100 Grand Junction, CO 81501 PH (970) 683-6284 FAX (970) 683-6290 R3 Traffic Section, Access Unit, 222 S. 6th Street, Rm 100, Grand Junction, CO 81501 PH (970) 683-6284 www.codot.gov <<<<< e-mailed >>>>> Permit No. 320017 February 1, 2020 MMME WG, LLC 6874 Hwy 82 Glenwood Springs, Colorado 81623 Dear Permittee: 1.Please review the attached State Highway Access Permit (Form #101) and all enclosed attachments. 2.If you choose NOT to act on the permit, please return the permit unsigned. 3.If you ACCEPT the Permit and its Terms and Conditions (and are authorized to sign as legal owner of the property, or as an authorized representative), please sign and date the Access Permit form on the line marked “PERMITTEE” within 60 days of the transmittal date on the permit. Your signature confirms your agreement to all the listed Terms and Conditions. 4.If you fail to sign and return the attached Access Permit within 60 days of the permit transmittal date, the Colorado Department of Transportation (CDOT) will consider this permit withdrawn. 5.You must return the signed Access Permit hard copies with original signature(s), including all pages of terms and conditions and all attachments, with your payment to the Colorado Department of Transportation (CDOT) at the address noted below. The Department will return an executed copy of this permit. You may retain this cover letter for your records. 6.Provide a check or money order made payable to “CDOT” for the total amount due of $100.00. 7.If you wish to APPEAL the Terms and Conditions of the permit, please refer to the attached Form 101, Pages 2 and 3 for an explanation of the appeal procedures. 8.As described in the additional attached Terms and Conditions, you must make a written request to obtain a Notice to Proceed. DO NOT begin any work within the State Highway Right-of-Way without a validated Access Permit and Notice to Proceed. Use of this permit without the Colorado Department of Transportation’s validation shall be considered a violation of State Law. If you have any questions please call Kandis Aggen, Access Coordinator, at (970) 683-6270 or Brian Killian, Region 3 Permit Manager, at the number above. Please return Access Permit and attachments to: Region 3 Access Unit Attn: Kandis Aggen, Access Coordinator 222 S 6th St, Rm 100 Grand Junction, CO 81501 COLORADO Department of Transportation Region3 &2/25$'2'(3$570(172)75$163257$7,21 67$7(+,*+:$<$&&(663(50,7 &'273HUPLW1R 6WDWH+LJKZD\1R0S6LGH $/HIW 3HUPLW)HH 'DWHRI7UDQVPLWWDO 5HJLRQ6HFWLRQ3DWURO1DPH .$ODQ+D\HV /RFDO-XULVGLFWLRQ *OHQZRRG6SULQJV 7KH3HUPLWWHH V 000(:*//& +Z\ *OHQZRRG6SULQJV&RORUDGR 7KH$SSOLFDQW V 6RSULV(QJLQHHULQJ//& 0DLQ6W6WH$ &DUERQGDOH&RORUDGR LVKHUHE\JUDQWHGSHUPLVVLRQWRKDYHDQDFFHVVWRWKHVWDWHKLJKZD\DWWKHORFDWLRQQRWHGEHORZ7KHDFFHVVVKDOOEHFRQVWUXFWHGPDLQWDLQHGDQGXVHGLQ DFFRUGDQFHZLWKWKLVSHUPLWLQFOXGLQJWKH6WDWH+LJKZD\$FFHVV&RGHDQGDQ\DWWDFKPHQWVWHUPVFRQGLWLRQVDQGH[KLELWV7KLVSHUPLWPD\EHUHYRNHG E\WKH,VVXLQJ$XWKRULW\LIDWDQ\WLPHWKHSHUPLWWHGDFFHVVDQGLWVXVHYLRODWHDQ\SDUWVRIWKLVSHUPLW7KHLVVXLQJDXWKRULW\WKH'HSDUWPHQWDQGWKHLUGXO\ DSSRLQWHGDJHQWVDQGHPSOR\HHVVKDOOEHKHOGKDUPOHVVDJDLQVWDQ\DFWLRQIRUSHUVRQDOLQMXU\RUSURSHUW\GDPDJHVXVWDLQHGE\UHDVRQRIWKHH[HUFLVHRI WKHSHUPLW /RFDWLRQ /RFDWHGRQWKHQRUWKVLGHRI+Z\$1RUWK)URQWDJH5GDSSUR[LPDWHO\IHHWHDVWRIWKHZHVWHQGRIWKH)URQWDJH5G DQGIHHWHDVWRI03 $FFHVVWR3URYLGH6HUYLFHWR /DQG8VH&RGH 6L]H 8QLWV 6LQJOH)DPLO\'HWDFKHG+RXVLQJ([LVWLQJ'+9 &DPSJURXQG5HFUHDWLRQDO9HKLFOH3DUN'+9 7RWDO9ROXPH'+9 $GGLWLRQDO,QIRUPDWLRQ 7KLVDFFHVVLVORFDWHGRQWKH,)5DSSUR[LPDWH0LOH3RLQWZHVWRI([LWLQWHUFKDQJH 081,&,3$/,7<25&2817<$33529$/ 5HTXLUHGRQO\ZKHQWKHDSSURSULDWHORFDODXWKRULW\UHWDLQVLVVXLQJDXWKRULW\ 6LJQDWXUH 3ULQW1DPH 'DWH 7LWOH 8SRQWKHVLJQLQJRIWKLVSHUPLWWKHSHUPLWWHHDJUHHVWRWKHWHUPVDQGFRQGLWLRQVDQGUHIHUHQFHGDWWDFKPHQWVFRQWDLQHG KHUHLQ$OOFRQVWUXFWLRQVKDOOEHFRPSOHWHGLQDQH[SHGLWLRXVDQGVDIHPDQQHUDQGVKDOOEHILQLVKHGZLWKLQGD\VIURP ,QLWLDWLRQ7KHSHUPLWWHGDFFHVVVKDOOEHFRPSOHWHGLQDFFRUGDQFHZLWKWKHWHUPVDQGFRQGLWLRQVRIWKHSHUPLWSULRUWR EHLQJXVHG 7KHSHUPLWWHHVKDOOQRWLI\/HV6WDQWRQ.ZLWKWKH&RORUDGR'HSDUWPHQWRI7UDQVSRUWDWLRQDW DW OHDVWKRXUVSULRUWRFRPPHQFLQJFRQVWUXFWLRQZLWKLQWKH6WDWH+LJKZD\ULJKWRIZD\ 7KHSHUVRQVLJQLQJDVWKHSHUPLWWHHPXVWEHWKHRZQHURUOHJDOUHSUHVHQWDWLYHRIWKHSURSHUW\VHUYHGE\WKHSHUPLWWHGDFFHVVDQGKDYHIXOODXWKRULW\WR DFFHSWWKHSHUPLWDQGLWVWHUPVDQGFRQGLWLRQV 3HUPLWWHH6LJQDWXUH 3ULQW1DPH'DWH &R3HUPLWWHH6LJQDWXUH LIDSSOLFDEOH 3ULQW1DPH'DWH 7KLVSHUPLWLVQRWYDOLGXQWLOVLJQHGE\DGXO\DXWKRUL]HGUHSUHVHQWDWLYHRIWKH'HSDUWPHQW &2/25$'2'(3$570(172)75$163257$7,21 6LJQDWXUH3ULQW1DPH7LWOH 'DWH RILVVXH &RS\'LVWULEXWLRQ 5HTXLUHG 5HJLRQ 6WDII$FFHVV6HFWLRQ $SSOLFDQW &HQWUDO)LOHV 0DNHFRSLHVDVQHFHVVDU\IRU 3UHYLRXVHGLWLRQVDUHREVROHWHDQGPD\QRWEHXVHG /RFDO$XWKRULW\ ,QVSHFWRU3DJHRI&'27)RUP 07&(3DWURO 7UDIILF(QJLQHHU ?V??Q??G? ?V??Q??W??G?I I I 6WDWH+LJKZD\$FFHVV3HUPLW )RUP3DJH 7KHIROORZLQJSDUDJUDSKVDUHH[FHUSWVRIWKH6WDWH+LJKZD\ $FFHVV&RGH7KHVHDUHSURYLGHGIRU\RXUFRQYHQLHQFHEXW GRQRWDOOHYLDWHFRPSOLDQFHZLWKDOOVHFWLRQVRIWKH$FFHVV &RGH$FRS\RIWKH6WDWH+LJKZD\$FFHVV&RGHLVDYDLODEOH IURP\RXUORFDOLVVXLQJDXWKRULW\ ORFDOJRYHUQPHQW RUWKH &RORUDGR 'HSDUWPHQW RI 7UDQVSRUWDWLRQ 'HSDUWPHQW :KHQWKLVSHUPLWZDVLVVXHGWKHLVVXLQJDXWKRULW\PDGHLWV GHFLVLRQ EDVHG LQ SDUW RQ LQIRUPDWLRQ VXEPLWWHG E\ WKH DSSOLFDQWRQWKHDFFHVVFDWHJRU\ZKLFKLVDVVLJQHGWRWKH KLJKZD\ZKDWDOWHUQDWLYHDFFHVVWRRWKHUSXEOLFURDGVDQG VWUHHWV LV DYDLODEOH DQG VDIHW\ DQG GHVLJQ VWDQGDUGV &KDQJHVLQXVHRUGHVLJQQRWDSSURYHGE\WKHSHUPLWRUWKH LVVXLQJDXWKRULW\PD\FDXVHWKHUHYRFDWLRQRUVXVSHQVLRQRI WKHSHUPLW $33($/6 6KRXOGWKHSHUPLWWHHRUDSSOLFDQWREMHFWWRWKHGHQLDORI DSHUPLWDSSOLFDWLRQE\WKH'HSDUWPHQWRUREMHFWWRDQ\RIWKH WHUPV RU FRQGLWLRQV RI D SHUPLW SODFHG WKHUH E\ WKH 'HSDUWPHQWWKHDSSOLFDQWDQGSHUPLWWHH DSSHOODQW KDYHD ULJKW WR DSSHDO WKH GHFLVLRQ WR WKH >7UDQVSRUWDWLRQ@ &RPPLVVLRQ>RI&RORUDGR@7RDSSHDODGHFLVLRQVXEPLWD UHTXHVW IRU DGPLQLVWUDWLYH KHDULQJ WR WKH 7UDQVSRUWDWLRQ &RPPLVVLRQ RI &RORUDGR ZLWKLQ GD\V RI WUDQVPLWWDO RI QRWLFH RI GHQLDO RU WUDQVPLWWDO RI WKH SHUPLW IRU VLJQDWXUH 6XEPLW WKH UHTXHVW WR WKH 7UDQVSRUWDWLRQ &RPPLVVLRQ RI &RORUDGR(DVW$UNDQVDV$YHQXH'HQYHU&RORUDGR 7KH UHTXHVW VKDOO LQFOXGH UHDVRQV IRU WKH DSSHDODQGPD\LQFOXGHFKDQJHVUHYLVLRQVRUFRQGLWLRQV WKDWZRXOGEHDFFHSWDEOHWRWKHSHUPLWWHHRUDSSOLFDQW $Q\DSSHDOE\WKHDSSOLFDQWRUSHUPLWWHHRIDFWLRQE\D ORFDOLVVXLQJDXWKRULW\VKDOOEHILOHGZLWKWKHORFDODXWKRULW\ DQGEHFRQVLVWHQWZLWKWKHDSSHDOSURFHGXUHVRIWKHORFDO DXWKRULW\ ,QVXEPLWWLQJWKHUHTXHVWIRUDGPLQLVWUDWLYHKHDULQJWKH DSSHOODQW KDV WKH RSWLRQ RI LQFOXGLQJ ZLWKLQ WKH DSSHDO D UHTXHVW IRU D UHYLHZ E\ WKH 'HSDUWPHQW¶V LQWHUQDO DGPLQLVWUDWLYH UHYLHZ FRPPLWWHH SXUVXDQW WR >&RGH@ VXEVHFWLRQ:KHQVXFKFRPPLWWHHUHYLHZLVUHTXHVWHG SURFHVVLQJRIWKHDSSHDOIRUIRUPDODGPLQLVWUDWLYHKHDULQJ DQG VKDOOEHVXVSHQGHGXQWLOWKHDSSHOODQWQRWLILHV WKH&RPPLVVLRQWRSURFHHGZLWKWKHDGPLQLVWUDWLYHKHDULQJ RUWKHDSSHOODQWVXEPLWVDUHTXHVWWRWKH&RPPLVVLRQRUWKH DGPLQLVWUDWLYHODZMXGJHWRZLWKGUDZWKHDSSHDO7KHWZR DGPLQLVWUDWLYHSURFHVVHVWKHLQWHUQDODGPLQLVWUDWLYHUHYLHZ FRPPLWWHH DQG WKH DGPLQLVWUDWLYH KHDULQJ PD\ QRW UXQ FRQFXUUHQWO\ 5HJDUGOHVV RI DQ\ FRPPXQLFDWLRQV PHHWLQJV DGPLQLVWUDWLYHUHYLHZVRUQHJRWLDWLRQVZLWKWKH'HSDUWPHQW RUWKHLQWHUQDODGPLQLVWUDWLYHUHYLHZ&RPPLWWHHUHJDUGLQJ UHYLVLRQV RU REMHFWLRQV WR WKH SHUPLW RU D GHQLDO LI WKH SHUPLWWHHRUDSSOLFDQWZLVKHVWRDSSHDOWKH'HSDUWPHQW V GHFLVLRQWRWKH&RPPLVVLRQIRUDKHDULQJWKHDSSHDOPXVW EHEURXJKWWRWKH&RPPLVVLRQZLWKLQGD\VRIWUDQVPLWWDO RIQRWLFHRIGHQLDORUWUDQVPLWWDORIWKHSHUPLW 3(50,7(;3,5$7,21 $SHUPLWVKDOOEHFRQVLGHUHGH[SLUHGLIWKHDFFHVVLVQRW XQGHUFRQVWUXFWLRQZLWKLQRQH\HDURIWKHSHUPLWLVVXHGDWH RUEHIRUHWKHH[SLUDWLRQRIDQ\DXWKRUL]HGH[WHQVLRQ:KHQ WKHSHUPLWWHHLVXQDEOHWRFRPPHQFHFRQVWUXFWLRQZLWKLQRQH \HDUDIWHUWKHSHUPLWLVVXHGDWHWKHSHUPLWWHHPD\UHTXHVWD RQH\HDUH[WHQVLRQIURPWKHLVVXLQJDXWKRULW\1RPRUHWKDQ WZR RQH\HDU H[WHQVLRQV PD\ EH JUDQWHG XQGHU DQ\ FLUFXPVWDQFHV,IWKHDFFHVVLVQRWXQGHUFRQVWUXFWLRQZLWKLQ WKUHH\HDUVIURPGDWHRILVVXHWKHSHUPLWZLOOEHFRQVLGHUHG H[SLUHG$Q\UHTXHVWIRUDQH[WHQVLRQPXVWEHLQZULWLQJDQG VXEPLWWHGWRWKHLVVXLQJDXWKRULW\EHIRUHWKHSHUPLWH[SLUHV 7KHUHTXHVWVKRXOGVWDWHWKHUHDVRQVZK\WKHH[WHQVLRQLV QHFHVVDU\ZKHQFRQVWUXFWLRQLVDQWLFLSDWHGDQGLQFOXGHD FRS\ RI SDJH IDFH RI SHUPLW RI WKH DFFHVV SHUPLW ([WHQVLRQDSSURYDOVVKDOO EHLQ ZULWLQJ7KHORFDOLVVXLQJ DXWKRULW\ VKDOO REWDLQ WKH FRQFXUUHQFH RI WKH 'HSDUWPHQW SULRUWRWKHDSSURYDORIDQH[WHQVLRQDQGVKDOOQRWLI\WKH 'HSDUWPHQWRIDOOGHQLHGH[WHQVLRQVZLWKLQWHQGD\V$Q\ SHUVRQ ZLVKLQJ WR UHHVWDEOLVK DQ DFFHVV SHUPLW WKDW KDV H[SLUHGPD\EHJLQDJDLQZLWKWKHDSSOLFDWLRQSURFHGXUHV$Q DSSURYHG 1RWLFH WR 3URFHHG DXWRPDWLFDOO\ UHQHZV WKH DFFHVVSHUPLWIRUWKHSHULRGRIWKH1RWLFHWR3URFHHG &216758&7,21 &RQVWUXFWLRQPD\QRWEHJLQXQWLOD1RWLFHWR3URFHHGLV DSSURYHG &RGHVXEVHFWLRQ@ 7KHFRQVWUXFWLRQRIWKHDFFHVVDQGLWVDSSXUWHQDQFHVDV UHTXLUHGE\WKHWHUPVDQGFRQGLWLRQVRIWKHSHUPLWVKDOOEH FRPSOHWHG DW WKH H[SHQVH RI WKH SHUPLWWHH H[FHSW DV SURYLGHG LQ VXEVHFWLRQ $OO PDWHULDOV XVHG LQ WKH FRQVWUXFWLRQRIWKHDFFHVVZLWKLQWKHKLJKZD\ULJKWRIZD\RU RQ SHUPDQHQW HDVHPHQWV EHFRPH SXEOLF SURSHUW\ $Q\ PDWHULDOV UHPRYHG IURP WKH KLJKZD\ ULJKWRIZD\ ZLOO EH GLVSRVHGRIRQO\DVGLUHFWHGE\WKH'HSDUWPHQW$OOIHQFLQJ JXDUGUDLOWUDIILFFRQWUROGHYLFHVDQGRWKHUHTXLSPHQWDQG PDWHULDOVUHPRYHGLQWKHFRXUVHRIDFFHVVFRQVWUXFWLRQVKDOO EHJLYHQWRWKH'HSDUWPHQWXQOHVVRWKHUZLVHLQVWUXFWHGE\ WKHSHUPLWRUWKH'HSDUWPHQWLQVSHFWRU 7KH SHUPLWWHH VKDOO QRWLI\ WKH LQGLYLGXDO RU WKH RIILFH VSHFLILHGRQWKHSHUPLWRU1RWLFHWR3URFHHGDWOHDVWWZR ZRUNLQJGD\VSULRUWRDQ\FRQVWUXFWLRQZLWKLQVWDWHKLJKZD\ ULJKWRIZD\&RQVWUXFWLRQRIWKHDFFHVVVKDOOQRWSURFHHG XQWLOERWKWKHDFFHVVSHUPLWDQGWKH1RWLFHWR3URFHHGDUH LVVXHG7KHDFFHVVVKDOOEHFRPSOHWHGLQDQH[SHGLWLRXVDQG VDIH PDQQHU DQG VKDOO EH ILQLVKHG ZLWKLQ GD\V IURP LQLWLDWLRQRIFRQVWUXFWLRQZLWKLQWKHKLJKZD\ULJKWRIZD\$ FRQVWUXFWLRQWLPHH[WHQVLRQQRWWRH[FHHGZRUNLQJGD\V PD\EHUHTXHVWHGIURPWKHLQGLYLGXDORURIILFHVSHFLILHGRQ WKHSHUPLW 7KHLVVXLQJDXWKRULW\DQGWKH'HSDUWPHQWPD\LQVSHFW WKHDFFHVVGXULQJFRQVWUXFWLRQDQGXSRQFRPSOHWLRQRIWKH DFFHVVWRHQVXUHWKDWDOOWHUPVDQGFRQGLWLRQVRIWKHSHUPLW DUHPHW,QVSHFWRUVDUHDXWKRUL]HGWRHQIRUFHWKHFRQGLWLRQV RIWKHSHUPLWGXULQJFRQVWUXFWLRQDQGWRKDOWDQ\DFWLYLWLHV ZLWKLQ VWDWH ULJKWRIZD\ WKDW GR QRW FRPSO\ ZLWK WKH SURYLVLRQVRIWKHSHUPLWWKDWFRQIOLFWZLWKFRQFXUUHQWKLJKZD\ FRQVWUXFWLRQRUPDLQWHQDQFHZRUNWKDWHQGDQJHUKLJKZD\ SURSHUW\QDWXUDORUFXOWXUDOUHVRXUFHVSURWHFWHGE\ODZRU WKHKHDOWKDQGVDIHW\RIZRUNHUVRUWKHSXEOLF ?L? 3ULRUWRXVLQJWKHDFFHVVWKHSHUPLWWHHLVUHTXLUHGWR FRPSOHWH WKH FRQVWUXFWLRQ DFFRUGLQJ WR WKH WHUPV DQG FRQGLWLRQVRIWKHSHUPLW)DLOXUHE\WKHSHUPLWWHHWRDELGHE\ DOOSHUPLWWHUPVDQGFRQGLWLRQVVKDOOEHVXIILFLHQWFDXVHIRU WKH 'HSDUWPHQW RU LVVXLQJ DXWKRULW\ WR LQLWLDWH DFWLRQ WR VXVSHQGRUUHYRNHWKHSHUPLWDQGFORVHWKHDFFHVV,ILQWKH GHWHUPLQDWLRQ RI WKH 'HSDUWPHQW RU LVVXLQJ DXWKRULW\ WKH IDLOXUH WR FRPSO\ ZLWK RU FRPSOHWH WKH FRQVWUXFWLRQ UHTXLUHPHQWVRIWKHSHUPLWFUHDWHDKLJKZD\VDIHW\KD]DUG VXFKVKDOOEHVXIILFLHQWFDXVHIRUWKHVXPPDU\VXVSHQVLRQ RIWKHSHUPLW,IWKHSHUPLWWHHZLVKHVWRXVHWKHDFFHVVSULRU WR FRPSOHWLRQ DUUDQJHPHQWV PXVW EH DSSURYHG E\ WKH LVVXLQJDXWKRULW\DQG'HSDUWPHQWDQGLQFOXGHGLQWKHSHUPLW 7KH'HSDUWPHQWRULVVXLQJDXWKRULW\PD\RUGHUDKDOWWRDQ\ XQDXWKRUL]HGXVHRIWKHDFFHVVSXUVXDQWWRVWDWXWRU\DQG UHJXODWRU\ SRZHUV 5HFRQVWUXFWLRQ RU LPSURYHPHQW RI WKH DFFHVVPD\EHUHTXLUHGZKHQWKHSHUPLWWHHKDVIDLOHGWR PHHWUHTXLUHGVSHFLILFDWLRQVRIGHVLJQRUPDWHULDOV,IDQ\ FRQVWUXFWLRQHOHPHQWIDLOVZLWKLQWZR\HDUVGXHWRLPSURSHU FRQVWUXFWLRQRUPDWHULDOVSHFLILFDWLRQVWKHSHUPLWWHHVKDOOEH UHVSRQVLEOHIRUDOOUHSDLUV)DLOXUHWRPDNHVXFKUHSDLUVPD\ UHVXOWLQVXVSHQVLRQRIWKHSHUPLWDQGFORVXUHRIWKHDFFHVV 7KHSHUPLWWHHVKDOOSURYLGHFRQVWUXFWLRQWUDIILFFRQWURO GHYLFHV DW DOO WLPHV GXULQJ DFFHVV FRQVWUXFWLRQ LQ FRQIRUPDQFHZLWKWKH087&'DVUHTXLUHGE\VHFWLRQ &56DVDPHQGHG $XWLOLW\SHUPLWVKDOOEHREWDLQHGIRUDQ\XWLOLW\ZRUNZLWKLQ KLJKZD\ULJKWRIZD\:KHUHQHFHVVDU\WRUHPRYHUHORFDWH RUUHSDLUDWUDIILFFRQWUROGHYLFHRUSXEOLFRUSULYDWHXWLOLWLHVIRU WKH FRQVWUXFWLRQ RI D SHUPLWWHG DFFHVV WKH UHORFDWLRQ UHPRYDORUUHSDLUVKDOOEHDFFRPSOLVKHGE\WKHSHUPLWWHH ZLWKRXWFRVWWRWKH'HSDUWPHQWRULVVXLQJDXWKRULW\DQGDW WKH GLUHFWLRQ RI WKH 'HSDUWPHQW RU XWLOLW\ FRPSDQ\ $Q\ GDPDJH WR WKH VWDWH KLJKZD\ RU RWKHU SXEOLF ULJKWRIZD\ EH\RQGWKDWZKLFKLVDOORZHGLQWKHSHUPLWVKDOOEHUHSDLUHG LPPHGLDWHO\7KHSHUPLWWHHLVUHVSRQVLEOHIRUWKHUHSDLURI DQ\XWLOLW\GDPDJHGLQWKHFRXUVHRIDFFHVVFRQVWUXFWLRQ UHFRQVWUXFWLRQRUUHSDLU ,QWKHHYHQWLWEHFRPHVQHFHVVDU\WRUHPRYHDQ\ULJKW RIZD\IHQFHWKHSRVWVRQHLWKHUVLGHRIWKHDFFHVVVKDOOEH VHFXUHO\EUDFHGZLWKDQDSSURYHGHQGSRVWEHIRUHWKHIHQFH LVFXWWRSUHYHQWDQ\VODFNLQJRIWKHUHPDLQLQJIHQFH$OO SRVWVDQGZLUHUHPRYHGDUH'HSDUWPHQWSURSHUW\DQGVKDOO EHWXUQHGRYHUWRDUHSUHVHQWDWLYHRIWKH'HSDUWPHQW 7KHSHUPLWWHHVKDOOHQVXUHWKDWDFRS\RIWKHSHUPLWLV DYDLODEOHIRUUHYLHZDWWKHFRQVWUXFWLRQVLWHDWDOOWLPHV7KH SHUPLWPD\UHTXLUHWKHFRQWUDFWRUWRQRWLI\WKHLQGLYLGXDORU RIILFH VSHFLILHG RQ WKH SHUPLW DW DQ\ VSHFLILHG SKDVHV LQ FRQVWUXFWLRQWRDOORZWKHILHOGLQVSHFWRUWRLQVSHFWYDULRXV DVSHFWVRIFRQVWUXFWLRQVXFKDVFRQFUHWHIRUPVVXEEDVH EDVHFRXUVHFRPSDFWLRQDQGPDWHULDOVVSHFLILFDWLRQV0LQRU FKDQJHVDQGDGGLWLRQVPD\EHRUGHUHGE\WKH'HSDUWPHQW RUORFDODXWKRULW\ILHOGLQVSHFWRUWRPHHWXQDQWLFLSDWHGVLWH FRQGLWLRQV (DFKDFFHVVVKDOOEHFRQVWUXFWHGLQDPDQQHUWKDWVKDOO QRWFDXVHZDWHUWRHQWHURQWRWKHURDGZD\RUVKRXOGHUDQG VKDOOQRWLQWHUIHUHZLWKWKHH[LVWLQJGUDLQDJHV\VWHPRQWKH ULJKWRIZD\RUDQ\DGRSWHGPXQLFLSDOV\VWHPDQGGUDLQDJH SODQ %\ DFFHSWLQJ WKH SHUPLW SHUPLWWHH DJUHHV WR VDYH LQGHPQLI\DQGKROGKDUPOHVVWRWKHH[WHQWDOORZHGE\ODZ WKH LVVXLQJ DXWKRULW\ WKH 'HSDUWPHQW LWV RIILFHUV DQG HPSOR\HHV IURP VXLWV DFWLRQV FODLPV RI DQ\ W\SH RU FKDUDFWHUEURXJKWEHFDXVHRILQMXULHVRUGDPDJHVXVWDLQHG E\ DQ\ SHUVRQ UHVXOWLQJ IURP WKH SHUPLWWHH V XVH RI WKH DFFHVVSHUPLWGXULQJWKHFRQVWUXFWLRQRIWKHDFFHVV &+$1*(6,1$&&(6686($1'3(50,79,2/$7,216 ,W LV WKH UHVSRQVLELOLW\ RI WKH SURSHUW\ RZQHU DQG SHUPLWWHHWRHQVXUHWKDWWKHXVHRIWKHDFFHVVWRWKHSURSHUW\ LVQRWLQYLRODWLRQRIWKH&RGHSHUPLWWHUPVDQGFRQGLWLRQVRU WKH$FW7KHWHUPVDQGFRQGLWLRQVRIDQ\SHUPLWDUHELQGLQJ XSRQ DOO DVVLJQV VXFFHVVRUVLQLQWHUHVW KHLUV DQG RFFXSDQWV,IDQ\VLJQLILFDQWFKDQJHVDUHPDGHRUZLOOEH PDGH LQ WKH XVH RI WKH SURSHUW\ ZKLFK ZLOO DIIHFW DFFHVV RSHUDWLRQWUDIILFYROXPHDQGRUYHKLFOHW\SHWKHSHUPLWWHHRU SURSHUW\RZQHUVKDOOFRQWDFWWKHORFDOLVVXLQJDXWKRULW\RUWKH 'HSDUWPHQW WR GHWHUPLQH LI D QHZ DFFHVV SHUPLW DQG PRGLILFDWLRQVWRWKHDFFHVVDUHUHTXLUHG :KHQDQDFFHVVLVFRQVWUXFWHGRUXVHGLQYLRODWLRQRI WKH&RGHVHFWLRQ F &56RIWKH$FWDSSOLHV 7KH'HSDUWPHQWRULVVXLQJDXWKRULW\PD\VXPPDULO\VXVSHQG DQ DFFHVV SHUPLW DQG LPPHGLDWHO\ RUGHU FORVXUH RI WKH DFFHVVZKHQLWVFRQWLQXHGXVHSUHVHQWVDQLPPHGLDWHWKUHDW WR SXEOLF KHDOWK ZHOIDUH RU VDIHW\ 6XPPDU\ VXVSHQVLRQ VKDOOFRPSO\ZLWKDUWLFOHRIWLWOH&56 0$,17(1$1&( 7KHSHUPLWWHHKLVRUKHUKHLUVVXFFHVVRUVLQLQWHUHVW DVVLJQV DQG RFFXSDQWV RI WKH SURSHUW\ VHUYLFHG E\ WKH DFFHVV VKDOO EH UHVSRQVLEOH IRU PHHWLQJ WKH WHUPV DQG FRQGLWLRQVRIWKHSHUPLWWKHUHSDLUDQGPDLQWHQDQFHRIWKH DFFHVVEH\RQGWKHHGJHRIWKHURDGZD\LQFOXGLQJDQ\FDWWOH JXDUGDQGJDWHDQGWKHUHPRYDORUFOHDUDQFHRIVQRZRULFH XSRQWKHDFFHVVHYHQWKRXJKGHSRVLWHGRQWKHDFFHVVLQWKH FRXUVH RI 'HSDUWPHQW VQRZ UHPRYDO RSHUDWLRQV :LWKLQ XQLQFRUSRUDWHG DUHDV WKH 'HSDUWPHQW ZLOO NHHS DFFHVV FXOYHUWV FOHDQ DV SDUW RI PDLQWHQDQFH RI WKH KLJKZD\ GUDLQDJHV\VWHP+RZHYHUWKHSHUPLWWHHLVUHVSRQVLEOHIRU WKHUHSDLUDQGUHSODFHPHQWRIDQ\DFFHVVUHODWHGFXOYHUWV ZLWKLQWKHULJKWRIZD\:LWKLQLQFRUSRUDWHGDUHDVGUDLQDJH UHVSRQVLELOLWLHVIRUPXQLFLSDOLWLHVDUHGHWHUPLQHGE\VWDWXWH DQG ORFDO RUGLQDQFH 7KH 'HSDUWPHQW ZLOO PDLQWDLQ WKH URDGZD\LQFOXGLQJDX[LOLDU\ODQHVDQGVKRXOGHUVH[FHSWLQ WKRVHFDVHVZKHUHWKHDFFHVVLQVWDOODWLRQKDVIDLOHGGXHWR LPSURSHUDFFHVVFRQVWUXFWLRQDQGRUIDLOXUHWRIROORZSHUPLW UHTXLUHPHQWVDQGVSHFLILFDWLRQVLQZKLFKFDVHWKHSHUPLWWHH VKDOOEHUHVSRQVLEOHIRUVXFKUHSDLU$Q\VLJQLILFDQWUHSDLUV VXFK DV FXOYHUW UHSODFHPHQW UHVXUIDFLQJ RU FKDQJHV LQ GHVLJQ RU VSHFLILFDWLRQV UHTXLUHV DXWKRUL]DWLRQ IURP WKH 'HSDUWPHQW )RUP3DJH ?L? STATE of COLORADO HIGHWAY ACCESS PERMIT ADDITIONAL TERMS and CONDITIONS PERMIT No. 320017 February 1, 2020 Permittee(s): MMME WG, LLC Location: Garfield County on CO Highway 070A, near Mile Ref. Pt. 113.147 Left This permitted access is only for the use and purpose stated in the Application and Permit. This Permit is issued in accordance with the State Highway Access Code (2 CCR 601-1), and is based in part upon the information submitted by the Permittee. Any subsequent relocation, reconstruction, or modifications to the access or changes in the traffic volume or traffic nature using the access shall be requested for by means of a new application. Any changes causing non-compliance with the Access Code may render this permit void, requiring a new permit. This permit replaces any and all additional access permits that may be in existence for this access. This permit is for 2 Single Family Homes and Recreational campground/RV Park The traffic volume shall be 60 DHV This access shall have a full turning-movement. This access shall be designed and constructed to CDOT’s design standards. Side slopes shall be at a 4:1 slope on the roadway. The roadway shall slope away from the highway at a -2% grade for the first 20 feet of driveway. This design shall be in conformance with section 4 of the State Highway Access Code, 2CCR 601-1. Immediately upon completion of earthwork, and prior to use, this access shall be hard surfaced in accordance with Section 4.7 of the Access. The access shall be hard-surfaced a minimum distance of 50 feet from the traveled way, or to the CDOT Right-of-Way, whichever is greater. Where the hard surface is to abut the existing pavement, the existing pavement shall be saw cut and removed a minimum of one foot back from the existing edge for bituminous, or until an acceptable existing cross slope is achieved. Surfacing shall meet the Department’s specifications with minimum surfacing to be equal to, or greater than, existing highway conditions. Materials, Placing, and Compaction Unless the Applicant has approval from the Access Manager who may state otherwise, the following are requirements for driveway construction: Hot Mix Asphalt Option (HMA) Base: 16 inches of class 6 gravel with maximum 6-inch lifts; Surface: 4 inches of HMA in two, 2-inch lifts; Compaction of the subgrade, embankments and backfill shall comply with sections 203 & 304 of the Colorado Highway Standard Specifications for Road and Bridge Construction. Concrete Pavement Option: Portland Cement (PCCP) Base: 4 inches of class 6 gravel; STATE of COLORADO HIGHWAY ACCESS PERMIT ADDITIONAL TERMS and CONDITIONS PERMIT No. 320017 February 1, 2020 Permittee(s): MMME WG, LLC Location: Garfield County on CO Highway 070A, near Mile Ref. Pt. 113.147 Left Surface: A minimum of 6” of doweled and tied PCCP. Compaction of the subgrade, embankments and backfill shall comply with sections 203 & 304 of the Colorado Highway Standard Specifications for Road and Bridge Construction. 12.A Notice to Proceed, CDOT Form 1265, must be issued by CDOT before beginning construction on the access or any activity within the highway Right-of-Way. 13.To receive the Notice to Proceed the applicant shall submit a complete packet to CDOT with the following items: (a)A cover letter requesting a Notice to Proceed. (b)Certificate of Insurance Liability as per Section 2.3(11)(i) of the State Highway Access Code, naming CDOT as an additional insured for general liability. (c)A certified Traffic Control Plan in accordance with Section 2.4(6) of the Access Code. The Traffic Control Plan shall provide accessibility features to accommodate all pedestrians including persons with disabilities for all pathways during construction. (d)Two copies of Construction Plans Stamped (11”x 17” with a minimum scale of 1” = 50’) by a Colorado Registered Professional Engineer in full compliance with the State Highway Access Code. 14.No drainage from this site shall enter onto the State Highway travel lanes. The Permittee is required to maintain all drainage in excess of historical flows and time of concentration on site. All existing drainage structures shall be extended, modified or upgraded, as applicable, to accommodate all new construction and safety standards, in accordance with the Department’s standard specifications. 15.Open cuts, which are at least 4 inches in depth, within 30 feet of the edge of the State Highway traveled way, will not be left open at night, on weekends, or on holidays, or shall be protected with a suitable barrier per State and Federal Standards. 16.Nothing in this permit shall prohibit the Chief Engineer from exercising the right granted in CRS 43- 3-102 Including but not limited to restricting left hand turns by construction of physical medial separations. 17.The Permittee is responsible for obtaining any necessary additional Federal, State and/or City/County permits or clearances required for construction of the access. Approval of this access permit does not constitute verification of this action by the Permittee. Permittee is also responsible for obtaining all necessary utility permits in addition to this access permit. 18.All workers within the State Highway right-of-way shall comply with their employer’s safety and health policies/procedures, and all applicable U.S. Occupational Safety and Health Administration (OSHA) regulations - including, but not limited to the applicable sections of 29 CFR Part 1910 - Occupational Safety and Health Standards and 29 CFR Part 1926 - Safety and Health Regulations for Construction. Personal protective equipment (e.g. head protection, footwear, high visibility apparel, safety glasses, hearing protection, respirators, gloves, etc.) shall be worn as appropriate for the work being performed, and as specified in regulation. 19.The Permittee shall provide accessibility features to accommodate all pedestrians including persons with disabilities for all pathways during and after construction. STATE of COLORADO HIGHWAY ACCESS PERMIT ADDITIONAL TERMS and CONDITIONS PERMIT No. 320017 February 1, 2020 Permittee(s): MMME WG, LLC Location: Garfield County on CO Highway 070A, near Mile Ref. Pt. 113.147 Left 20.The Permittee is required to comply with the Americans with Disabilities Act Accessibility Guidelines (ADAAG) that have been adopted by the U.S. Architectural and Transportation Barriers Compliance Board (Access Board), and incorporated by the U.S. Attorney General as a federal standard. These guidelines are defining traversable slope requirements and prescribing the use of a defined pattern of truncated domes as detectable warnings at street crossings. The new Standards Plans and can be found on the Design and Construction Project Support web page at: https://www.codot.gov/business/designsupport/standard-plans . 21.When it is necessary to remove any highway right-of-way fence, the posts on either side of the access entrance shall be securely braced with approved end posts and in conformance with the Department’s M-607-1 standard, before the fence is cut, to prevent slacking of the remaining fence. All materials removed shall be returned to the Department. 22.It shall be the responsibility of the Permittee to maintain adequate sight distance for this driveway. Trimming of vegetation or trees to maintain adequate sight distance is the sole responsibility of the Permittee. 23.The permittee, his or her heirs, successors-in-interest, assigns, and occupants of the property serviced by the access shall be responsible for meeting the terms and conditions of the permit, the repair and maintenance of the access beyond the edge of the roadway including any cattle guard and gate, and the removal or clearance of snow or ice upon the access even though deposited on the access in the course of Department snow removal operations. Within unincorporated areas the Department will keep access culverts clean as part of maintenance of the highway drainage system. However, the permittee is responsible for the repair and replacement of any access- related culverts within the right-of-way. Within incorporated areas, drainage responsibilities for municipalities are determined by statute and local ordinance. The Department will maintain the roadway including auxiliary lanes and shoulders, except in those cases where the access installation has failed due to improper access construction and/or failure to follow permit requirements and specifications in which case the permittee shall be responsible for such repair. Any significant repair such as culvert replacement, resurfacing, or changes in design or specifications, requires authorization from the Department. 24.Any damage to present highway facilities including traffic control devices shall be repaired immediately at no cost to the Department and prior to continuing other work. 25.During access construction, no construction-related, personal vehicles will be permitted to park in the state highway right-of-way. 26.Any mud or other material tracked, or otherwise deposited, on the roadway shall be removed daily or as ordered by the Department inspector. If mud is an obvious condition during site construction, it is recommended that the contractor build a Stabilized Construction Entrance or Scrubber Pad at the intended construction access to aid in the removal of mud and debris from vehicle tires. The details of the Stabilized Construction Entrance can be found in the M & S Standards Plan No. M-208-1. 27.A fully-executed, complete copy of this permit and the Notice to Proceed must be on the job site with the contractor at all times during the construction. Failure to comply with this or any other construction requirement may result in the immediate suspension of work by order of the Department inspector or the issuing authority. STATE of COLORADO HIGHWAY ACCESS PERMIT ADDITIONAL TERMS and CONDITIONS PERMIT No. 320017 February 1, 2020 Permittee(s): MMME WG, LLC Location: Garfield County on CO Highway 070A, near Mile Ref. Pt. 113.147 Left 28.No work will be allowed at night, Saturdays, Sundays and legal holidays without prior authorization from the Department. The Department may also restrict work within the State Highway right-of- way during adverse weather conditions. 29.The access shall be completed in an expeditious and safe manner and shall be completed within 45 days from initiation of construction within State Highway right-of-way or in accordance with written concurrence of the Access Manager. All construction shall be completed in a single season. 30.All costs associated with any type of utility work will be at the sole responsibility and cost of the Permittee and at no cost to CDOT. 31.Areas of roadway and/or right-of-way disturbed during this installation shall be restored to their original conditions to insure proper strength and stability, drainage and erosion control. Restoration shall meet the Department’s standard specifications for topsoil, fertilization, mulching, and re-seeding. 32.Upon the completion of the access (and prior to any use as allowed by this permit), the Applicant shall notify the Access Manager within 10 days to request a final inspection. This request shall include certification that all materials and construction have been completed in accordance with all applicable Department Standards and Specifications; and that the access is constructed in conformance with the State Highway Access Code, 2 CCR 601-1, including this permit. The Engineer of Record as indicated on the construction plans, may be requested by the Department for this inspection. The access serviced by this permit may not be opened to traffic until written approval has been given from the CDOT Access Manager. COLORADO DEPARTMENT OF TRANSPORTATION Environmental Clearances Information Summary PURPOSE - This summary is intended to inform entities external to CDOT that may be entering the state highway right-of-way to perform work related to their own facilities (such as Utility, Special Use or Access Permittees), about some of the more commonly encountered environmental permits/clearances that may apply to their activities. This listing is not all-inclusive - additional environmental or cultural resource permits/clearances may be required in certain instances. Appropriate local, state and federal agencies should be contacted for additional information if there is any uncertainty about what permits/clearances are required for a specific activity. IMPORTANT – Please Review The Following Information Carefully – Failure to Comply With Regulatory Requirements May Result In Suspension or Revocation of Your CDOT Permit, Or Enforcement Actions By Other Agencies. CLEARANCE CONTACTS - As indicated in the permit/clearance descriptions listed below, the following individuals or agencies may be contacted for additional information: x Colorado Department of Public Health and Environment (CDPHE): General Information – (303) 692-2035 Water Quality Control Division (WQCD): (303) 692-3500 Environmental Permitting Website https://www.colorado.gov/pacific/cdphe/all-permits x CDOT Water Quality Program Manager: (303) 757-9343 https://www.codot.gov/programs/environmental/water-quality x CDOT Asbestos Project Manager: Phil Kangas, (303) 512-5519 x Colorado Office of Archaeology and Historic Preservation: (303) 866-5216 x U.S. Army Corps of Engineers, District Regulatory Offices: Omaha District (NE CO), Denver Office (303) 979-4120 http://www.nwo.usace.army.mil/Missions/RegulatoryProgram/Colorado.aspx Sacramento Dist. (Western CO), Grand Junction Office (970) 243-1199 http://www.spk.usace.army.mil/Missions/Regulatory.aspx Albuquerque District (SE CO), Pueblo Office (719)-543-9459 http://www.spa.usace.army.mil/Missions/RegulatoryProgramandPermits.aspx x CDOT Utilities, Special Use and Access Permitting: (303) 757-9654 https://www.codot.gov/business/permits Wildlife Resources - Disturbance of wildlife shall be avoided to the maximum extent practicable. Entry into areas of known or suspected threatened or endangered species habitat will require special authorization from the CDOT permitting office. If any threatened or endangered species are encountered during the progress of the permitted work, work in the subject area shall be halted and the CDOT Regional Permitting Office and Region Planning and Environmental Manager shall be contacted immediately. Authorization must be provided by CDOT prior to the continuation of work. Information about threatened or endangered species may be obtained from the CDOT website, http://www.codot.gov/programs/environmental/wildlife/guidelines, or the Colorado Parks and Wildlife (CPW) website, http://www.cpw.state.co.us/learn/Pages/SOC-ThreatenedEndangeredList.aspx. Additional guidance may be provided by the appropriate Region Planning and Environmental Manager (RPEM). Cultural Resources - The applicant must request a file search of the permit area through the Colorado Office of Archaeology and Historic Preservation (OAHP), Denver, to ascertain if historic or archaeological resources have previously been identified (http://www.historycolorado.org/oahp/file-search). Inventory of the permit area by a qualified cultural resources specialist may be necessary, per the recommendation of CDOT. If archaeological sites/artifacts or historic resources are known to exist prior to the initiation of the permitted work or are encountered as the project progresses, all work in the subject area shall be halted and the CDOT Regional Permitting Office and Region Planning and Environmental Manager shall be contacted immediately. Authorization must be provided by CDOT prior to the continuation of work. Additional guidance may be provided by the Regional Permitting Office and RPEM. Contact Information: Contact the OAHP for file searches at (303) 866-5216. Paleontological Resources - The applicant must request a fossil locality file search through the University of Colorado Museum, Boulder (https://cumuseum.colorado.edu/research/paleontology/vertebrates/policies), and the Denver Museum of Nature and Science (http://www.dmns.org/science/collections/earth-science-collections/) to ascertain if paleontological resources have been previously identified in or near the permit area. Inventory of the permit area by a qualified paleontologist may be necessary, per the recommendation of CDOT. If fossils are encountered during the permitted work, all work in the subject area shall be halted and the CDOT Regional Permitting Office and Region Planning and Environmental Manager shall be contacted immediately. Authorization must be provided by CDOT prior to the continuation of work. Additional guidance may be provided by the Regional Permitting Office in the Permit Special Provisions. Contact Information: See the museum websites listed above for Paleontological Collections Manager contact information. Contact the CDOT Paleontologist for further information at nicole.peavey@state.co.us or (303) 757- 9632. The CDOT Paleontologist will not conduct a comprehensive file search independently of the museums. Hazardous Materials, Solid Waste - The Solid Wastes Disposal Sites and Facilities Act C.R.S. 30-20-100, et al, and Regulations Pertaining to Solid Waste Disposal Sites and Facilities (6 CCR 1007-2), prohibit solid waste disposal without an approved Certificate of Designation (a landfill permit). The Colorado Hazardous Waste Act C.R.S. 25-15-301 et al, and the Colorado Hazardous Waste Regulations (6 CCR 1007-3) prohibit the transfer, storage or disposal (TSD) of hazardous waste except at permitted TSD sites. There are no permitted landfills or TSD sites within the State Highway Right of Way. Therefore, all solid or hazardous wastes that might be generated by the activities of entities entering the State Highway Right of Way must be removed from the ROW and disposed of at a permitted facility or designated collection point (e.g., for solid waste, a utility or construction company’s own dumpster). If pre-existing solid waste or hazardous materials contamination (including oil or petroleum contaminated soil, asbestos, chemicals, mine tailings, etc.) is encountered during the performance of work, the permittee shall halt work in the affected area and immediately contact the CDOT Regional Permitting Office for direction as to how to proceed. Contact Information: Theresa Santangelo-Dreiling, CDOT Hazardous Materials Management Supervisor: (303) 512-5524. Asbestos Containing Materials, Asbestos Contaminated Soil - All work on asbestos containing materials (ACM) must comply with the applicable requirements of the CDPHE Air Pollution Control Division’s (APCD) Regulation 8. Disposal of ACM, and work done in asbestos-contaminated soil, must comply with the CDPHE Hazardous Materials and Waste Management Division’s (HMWMD) Solid Environmental Clearances Information Summary Page 1 of 3 Colorado Department of Transportation August 2017 Waste Regulations. The application for any CDOT permit must specifically identify any ACM involved in the work for which authorization is being requested. Additional guidance or requirements may be specified in the permit special provisions. Contact Info: CDPHE APCD and HMWMD Regulations can be accessed via the CDPHE Environmental Permitting Website listed above. Additional information concerning clearance on CDOT projects is available from the CDOT Asbestos Project Manager (303) 512- 5519, or Theresa Santangelo-Dreiling, Hazardous Materials Management Supervisor: (303) 512-5524. Transportation of Hazardous Materials - No person may offer or accept a hazardous material for transportation in commerce unless that person is registered in conformance with the United States Department of Transportation regulations at 49 CFR, Part 171. The hazardous material must be properly classed, described, packaged, marked, labeled, and in condition for shipment as required or authorized by applicable requirements, or an exemption, approval or registration has been issued. Vehicles requiring a placard, must obtain authorization and a State HAZMAT Permit from the Colorado Public Utilities Commission. Contact Information: For authorization and more info call the Federal Motor Safety Carrier Administration, US DOT for inter- and intra-state HAZMAT Registration (303) 969-6748. Colorado Public Utilities Commission: (303) 894-2868. Discharge of Dredged or Fill Material – 404 Permits Administered By the U.S. Army Corps of Engineers, and Section 401 Water Quality Certifications Issued by the CDPHE WQCD - Corps of Engineers 404 permits are required for the discharge of dredged or fill materials into waters of the United States, including wetlands. There are various types of 404 permits, including nationwide permits, which are issued for activities with relatively minor impacts. For example, there is a nationwide permit for utility line activities (nwp #12). Depending upon the specific circumstances, it is possible that either a “general” or “individual” 404 permit would be required. If an individual 404 permit is required, section 401 water quality certification from the CDPHE WQCD is also required. Contact the appropriate Corps District Regulatory Office for information about what type of 404 permit may be required (contact information above). Contact the CDPHE Water Quality Control Division at (303) 692-3500. Working on or in any stream or its bank - In order to protect and preserve the state’s fish and wildlife resources from actions that may obstruct, diminish, destroy, change, modify, or vary a natural existing stream or its banks or tributaries, it may be necessary to obtain a Senate Bill 40 certification from the Colorado Department of Natural Resources. A stream is defined as 1) represented by a solid blue line on USGS 7.5’ quadrangle maps; and/or 2) intermittent streams providing live water beneficial to fish and wildlife; and/or 3) segments of streams supporting 25% or more cover within 100 yards upstream or downstream of the project; and/or 4) segments of streams having wetlands present within 200 yards upstream or downstream of the project measured by valley length. The CPW application, as per guidelines agreed upon by CDOT and CPW, can be accessed at https://www.codot.gov/programs/environmental/ wildlife/guidelines. Stormwater Construction Permit (SCP) and Stormwater Discharge From Industrial Facilities - Discharges of stormwater runoff from construction sites disturbing one acre or more - or certain types of industrial facilities, such as concrete batch plants - require a CDPS Stormwater Permit. Contact Information: Contact the CDPHE Water Quality Control Division at (303) 692-3500. Website: https://www.colorado.gov/pacific/cdphe/wq-construction-general-permits and https://colorado.gov/pacific/cdphe/wq-commerce-and- industry-permits. Construction Dewatering (Discharge or Infiltration) and Remediation Activities - Discharges of water encountered during excavation or work in wet areas may require a Construction Dewatering or Remediation Activities Discharge Permit. Contact Information: For Construction Dewatering and Remediation Activities Discharge Permits, contact the CDPHE WQCD at (303) 692- 3500. For Applications and Instructions (CDPHE website): https://www.colorado.gov/pacific/cdphe/wq-construction-general-permits. Municipal Separate Storm Sewer System (MS4) Discharge Permit - Discharges from the storm sewer systems of larger municipalities, and from the CDOT highway drainage system that lies within those municipalities, are subject to MS4 Permits issued by the CDPHE WQCD. For facilities that lie within the boundaries of a municipality that is subject to an MS4 permit, the owner of such facility should contact the municipality regarding stormwater related clearances that may have been established under that municipality's MS4 permit. All discharges to the CDOT highway drainage system or within the Right of Way (ROW) must comply with the applicable provisions of the Colorado Water Quality Control Act, the Water Quality Control Commission (WQCC) Regulations (https://www.colorado.gov/pacific/cdphe/wqcc-regulations-and-policies-and-water-quality-statutes) and the CDOT MS4 Permit # COS- 000005 (https://www.codot.gov/programs/environmental/water-quality/documents). Discharges are subject to inspection by CDOT and CDPHE. Contact the CDPHE Water Quality Control Division at (303) 692-3500 for a listing of municipalities required to obtain MS4 Permits, or go to https://www.colorado.gov/pacific/cdphe/wq-municipal-ms4-permits. For CDOT-related MS4 regulations, go to: https://www.codot.gov/programs/environmental/water-quality/stormwater-programs.html. General Prohibition – Discharges - All discharges are subject to the provisions of the Colorado Water Quality Control Act and the Colorado Discharge Permit Regulations. Prohibited discharges include, but are not limited to, substances such as wash water, paint, automotive fluids, solvents, oils or soaps and sediment. Contact Information: Contact the CDPHE Water Quality Control Division at (303) 692-3500. General Authorization - Allowable Non-Stormwater Discharges - Unless otherwise identified by CDOT or the WQCD as significant sources of pollutants to the waters of the State, the following discharges to stormwater systems are allowed without a Colorado Discharge Permit System permit: landscape irrigation, diverted stream flows, uncontaminated ground water infiltration to separate storm sewers, discharges from potable water sources, foundation drains, air conditioning condensation, irrigation water, uncontaminated springs, footing drains, water line flushing, flows from riparian habitats and wetlands, and flow from firefighting activities. Allowable non-stormwater discharges can be found under Illicit Discharge PDD at: https://www.codot.gov/programs/ environmental/water-quality/stormwater-programs.html. Contact Information: The CDPHE Water Quality Control Division (telephone #’s listed above). Erosion and Sediment Control Practices - For activities requiring a Stormwater Construction Permit, erosion control requirements will be specified in that permit. In situations where a stormwater permit is not required, all reasonable measures should be taken to minimize erosion and sedimentation according to CDOT Standard Specifications 107.25, 208, 213 and 216 (https://www.codot.gov/ business/designsupport/2011-construction-specifications/2011-Specs/2011-specs-book). All disturbances require a stabilization plan, native seeding or landscape design plan according to applicable CDOT Standard Specifications 212-217 and 623. The CDOT Erosion Control and Stormwater Quality Guide (available from the Bid Plans Office at (303) 757-9313) should be used to design erosion controls and restore disturbed vegetation. Environmental Clearances Information Summary Page 2 of 3 Colorado Department of Transportation August 2017 Disposal of Drilling Fluids - Drilling fluids used in operations such as Horizontal Directional Drilling may be classified as “discharges” or “solid wastes,” and in general, should be pumped or vacuumed from the construction area, removed from the State Highway Right of Way, and disposed of at permitted facilities that specifically accept such wastes. Disposal of drilling fluids into storm drains, storm sewers, roadside ditches or any other type of man-made or natural waterway is prohibited by Water Quality Control and/or Solid Waste regulations. Small quantities of drilling fluid solids (less than 1 cubic yard of solids) may be left on-site after either being separated from fluids or after infiltration of the water, provided: 1) the drilling fluid consists of only water and bentonite clay, or, if required for proper drilling properties, small quantities of polymer additives that are approved for use in drinking water well drilling; 2) the solids are fully contained in a pit, and are not likely to pose a nuisance to future work in the area, 3) the solids are covered and the area restored as required by CDOT permit requirements (Utility, Special Use, or Access Permits, etc.). Contact Information: Contact CDPHE (telephone #’s listed above). Noxious Weeds and Invasive Species Management Plan – Noxious Weeds and Invasive Species guidance can be found by contacting the Colorado Department of Agriculture (https://www.colorado.gov/pacific/agconservation/noxiousweeds) and the Colorado Division of Parks and Wildlife (http://cpw.state.co.us/aboutus/Pages/RS-NoxiousWeeds.aspx). In either case, management plans involving the control of noxious weeds associated with the permitted activity and cleaning of equipment will be required. Concrete Washout - Waste generated from concrete activities shall NOT be allowed to flow into the drainage ways, inlets, receiving waters, or in the CDOT ROW. Concrete was te shall be placed in a temporary concrete washout facility and must be located a minimum of 50 feet from state waters, drainageways, and inlets. Concrete washout shall only be performed as specified by the CDOT Environmental Program and shall be in accordance to CDOT specifications and guidelines. Contact Information: Contact CDPHE or find additional information on the CDOT website: https://www.codot.gov/business/designsupport/2011-construction- specifications/2011-Specs and refer to the specifications and their revisions for sections 101, 107 and 208. Spill Reporting - Spills shall be contained and cleaned up as soon as possible. Spills shall NOT be washed down into the storm drain or buried. All spills shall be reported to the CDOT Illicit Discharge Hotline at (303) 512-4446 (4H20), as well as the Regional Permitting Office and Regional Maintenance Supervisor. Spills on highways, into waterways, any spill in the highway right-of-way exceeding 25 gallons, or that may otherwise present an immediate danger to the public shall be reported by calling 911, and shall also be reported to the CDPHE at 1-877-518-5608. More information can be found at https://www.colorado.gov/pacific/cdphe/emergency- reporting-line. About This Form - Questions or comments about this Information Summary may be directed to Alex Karami, Program Administrator, CDOT Access Management Unit, at (303) 757-9841, alex.karami@state.co.us. Environmental Clearances Information Summary Page 3 of 3 Colorado Department of Transportation August 2017 CDOThasaMunicipalSeparateStormSewerSystempermit,otherwiseknownas(MS4)fromtheColoradoDepartmentofPublicHealthandEnvironment.ThepermitstatesthatonlystormwatercanbedischargedfromCDOT’sstormdrainsystemAspartofthepermit,CDOThasseveraldifferentprogramstopreventpollutantsfromenteringintothestormdrainsystem:ConstructionSiteProgramNewDevelopmentRedevelopmentProgramIllicitDischargeProgramIndustrialFacilitiesProgramPublicEducationandOutreachProgramPollutionPreventionandGoodHousekeepingProgramWetWeatherMonitoringProgramWhatisstormwaterrunoff?Stormwaterrunoffoccurswhenprecipitationfromrainorsnowmeltflowsovertheground.ImpervioussurfaceslikeroadsandsidewalkspreventstormwaterfromnaturallysoakingintothegroundWhyisstormwaterrunoffaproblem?Stormwatercanpickupdebris,chemicals,dirtandotherpollutantsandflowintoCDOT’sstormdrainsystemordirectlyintoastream,river,lake,wetlandorreservoir.AnythingthatentersCDOT’sstormdrainsystemisdischargeduntreatedintothewaterwaysweuseforfishing,swimming,andprovidingdrinkingwater.FormoreinformationonCDOTUtilityPermits:https://www.codot.gov/business/permits/utilitiesspecialuseFormoreinformationonCDOTAccessPermits:https://www.codot.gov/business/permits/accesspermitsFormoreinformationonCDOTWaterQualityProgram:WaterQualityProgramManager4201E.ArkansasAve.ShumateBuildingDenver,Colorado80222303Ͳ757Ͳ9343Water Quality Program Industrial Facilities Program Dredgedspoil,dirt,slurry,solidwaste,incineratorresidue,sewage,sewagesludge,garbage,trash,chemicalwaste,biologicalnutrient,biologicalmaterial,radioactivematerial,heat,pH,wreckedordiscardedequipment,rock,sand,anyindustrial,municipal,oragriculturalwaste. TipsforReportinganIllicitDischarge Calltheillicitdischargehotlineat(303)512Ͳ4426 Fromasafedistancetrytoestimatetheamountofthedischarge. Identifycharacteristicsofthedischarge(color,odor,algae,etc.). Obtaininformationonthevehicledumpingthewaste(ifapplicable). Donotapproach! Call*CSPforillicitdumping. Ifpossible,takeaphoto,recordalicenseplate.REMEMBER: Nevergettooclosetotheillicitdischarge,itmaybedangerous!!! COLORADO Departmentof Transportation Drf'dgf'd sprnl, dirt, slurry, t, rock, sand TO THE WASTEWATER TREATMENT PLANT COLORADO Department of Transportation TOTHELOCAL WATERBOOY IndustrialFacilitiesProgramElements:1.Educateandoutreachtoownersoroperatorsthathavepotentialtocontributesubstantialpollutanttowater.2.Reportandincludeinformationondischargeandwaterqualityconcerns.Providewrittennotificationwithin15daysofdiscoverytoCDPHE.3.SubmitanannualreporttoCDPHEcontainingthenumberofinformationalbrochuresdistributed;nameandtitleofeachindividualtrained.EducationThereareinstanceswhenautilitycompanyorotherentitydoingworkinthestatehighwayrightͲofͲwaywillrequiresometypeofenvironmentalpermitorclearanceforthatwork.CDOThasputtogetheranEnvironmentalClearancesInformationSummaryforthoseapplyingforaCDOTUtilityandSpecialUsePermitorAccessPermittoobtainallrequiredclearances.Thisfactsheetisgiventoeachpermitteeandisavailableat: http://www.coloradodot.info/programs/environmental/resources/guidance-standards/Environmental%20Clearances%20Info%20Summary.pdfIndustrialfacilitiescanusecontrolmeasures(CM)otherwiseknownasBestManagementPractices(BMP)duringtheconstructionofafacilityandwhenoperatingthefacility.Controlmeasuresareschedulesofactivities,maintenanceprocedures,andothermanagementpracticestopreventandreducepollutionenteringintoCDOT’sstormdrainsystem.ControlMeasuresalsoincludetreatment,operatingprocedures,andpracticestocontrolsiterunoffwhichcanincludestructuralandnonͲstructuralcontrols.ControlMeasuresforIndustrialFacilitiesCDOTdefinesautility,orutilityfacilityasanyprivately,publicly,orcooperativelyownedline,facility,orsystemproducing,transmittingordistributingthefollowing:9Communications9Cabletelevision9Power9Electricity9Light9HeatGas9Oil9CrudeProducts9Water9Stream9Waste9Stormwater notconnectedwithhighwaydrainage9SimilarCommodityCOLORADO Departmentof Transportation THE 6AUNTLET 8¢:J __ , PROPERLY MAINTAINED? y In compliance!! COLORADO D partment of Transportation jf COLORADO DEPARTMENT OF TRANSPORTATION Issuing authority application STATE HIGHWAY ACCESS PERMIT APPLICATION acceptance date: Instructions: -Contact the Colorado Department of Transportation (COOT) or your local govemmentto determine your Issuing authority. -Contact the Issuing authority to determine what plans and other documents are required to be submitted with your appllcallon. Please print -Complete this form (some questions may not apply to you) and attach all necessary documents and Submit It to the Issuing authority. -Submit an application for each access affected. or type -If you have any questions contact the Issuing authority. -For additional Information see COOT's Access Management website at 1!1ms://www.codot.govlbuslnessle!rmlts/accesse!1rmlts 1) Property owner (Permittee) 2) Applicant or Agent for parmlttee (If different from property owner) NMNE WG,LLC C/0 NAJUt GOULD SOi>RI-S EBGIWERDIG, LLC C/O YANCY NICHOL Street address I Malling address 6874 HWY 82 502 Kllfl S'J:REE'l' StnTE A3 City, state & zip I Phone# City, state & zip ] Phone# (required) GLEN'NOOD SPRGS, CO 81623 (970) 945-7 2 91 CUBONDALE CO, 81623 (970)704-0311 E-mail address E-mail address If avallable MAR!C@GOOLDCONSTRUCTION .COM YNCIHOL@SOPJUSENG.COM 3) Address of property to be served by permit (required) 49993 6&24 HWY GLENWOOD SPlllNGS, COLORADO 81601 4) Legal description of property: If wHhlnJurlsdictlonal limlts of Munlclpalily, city and/or County, which one? oounly I subdMslan block IOI l i lan I ,wns111p I range GllP'IELD DICWR I FARCEL A&B I 1 90W 5) What State Highway are you requesting access from? 6) What side of the highway? ow SJ.ATE HI GHWAY 6'24 [i)N 0S □ E 7) How many feet Is the proposed access from the nearest mne post? I How many feet Is the proposed access from the nearest cross street? I 1330 teetnNns ■enW)from: I-70 113 2470 feetDNnsl7E ~from:KI'l'Clll!:L CREll (CR 132) 8) Whal is the approximate date you Intend lo begin construction? 4/1/2020 9) Check here If you are requesting a: Oimprovement lo existing access Onawaccess []temporary access (duration anticipated: ) li]change in access use □removal of access Oetocatlon of an existing access (provide detail) 10) Provide existing property use THERE lS CURRENTLY ONl!: ACCESS POINT TO 'fHE PARCEL SERVING, (2) llSIDBNTJ:A.L HOMES 11) Do you have knowledge of any State Highway access permits serving this property, or adjacent properties In which you have a property Interest? [;:]no Cl yes; If yes -what are the permit number(s) and provide copies: and/or, permit date: 12) Does Iha property owner own or have any Interests In any adjacent property? EJno Dyes, If yes • please describe: 13) Are there other existing or dedicated public streets, roads, highways or access easements bordering or within the property? mno IJyes, If yes -list them on your plans and Indicate the proposed and existing access points. 14) If you are requesting agricultural field access -how many acres will the access serve? N/A 15) If you are requesting commercial or industrial access please Indicate the types and number of businesses and provide the floor area square footage of each. buslnesslland use square footage business square footage QCRP.'l'IONA:L VEJJICLE PARK 117 .7 AC I I I 16) If you are requesting residential developement access, what Is the type (single family, apartment, townhouse) and number of units? lype number of units type number of units SINGLE FAMl'.LY HOME (EXISTING) 11 I I I 17) Provide the following vehicle count estimates for vehicles that wlll use the access. Leaving the property then returning Is two counts. Indicate If your counts are # of passenger cars and Ughl rruckll al pe~ hour volumes # of mum unit trucks at peak hour vah.Jmas l'!')peak hour volumes or □average dally volumes. 57 0 # ol single uni! vehicles In excess or 30 II. # or farm vehlcles (Held equlpmenl) Total count of all vehlcles 6 0 63- Previous editions ars obsolete and may not be uaad Paga1of2 CDOTForm#137 12/18 1 fl) Choclt Wilh tho issuing aull 101"ily lo dolor mine w; .... ,, of lho lullowing docum<Jnts nl'll (E!l\l•i rod !o C(J1<,11l1Jlo Ill<! rov:cw of your ar111ic (1fa11 ,. a) Pro11•mtvma11 lndicallng olher ac<:Ass, borclarlnn ro:irls and strnatt.. b) 1-frghway nnd driveway plan prolilA. ,;) Drainage plan showing Impact to lhe hluhway rlght-ol-way. d) Mop and letters dctalllng utlUly locations before and altor dovalopn1onl in and tdOll!J tho righl•ol-w·1y. o) Subdl11l;;!u11, 7.oniny, or uov<llopmont pl:m. I) Proposod acc~s:i docign. o) Parcel nnc:I ownornhl1) mnp(~ Including oa~,om01,1s. h) Traffic studies. i) Proof of ownership. 1-ll is the applicant's responsibility lo contact appropriate agencies and obtain all environmental clearances that apply to their activities. Such clearances may include Corps ot Engineers 404 Pel'mlts or Colorado Dii::charge Permit System permits, or ecological, al'Cheologlcal, historical or cuUuml resource clearances. The CDOT Environmental Cloarancos Information Summary presenls conlocl lnformalion for agencies adminislorlng corlain cloaranoos, Information about prohibiled discharges, and may b0 obtained Crom Regional COOT Utility/Spacial Use Permit offices or accessed via the COOT Plannlng/Co11structlo11-Environrnantal-Guidanca webpage: https:/lwww.codot.c,ov/progt·~ms/envlronmental/ · s urcei;/ ufdance-standarcls/env·ro1 me ital-lea ances-lnfo-summa -au ustM2017/vlew 2~ All workers within the State Highway right ot way shall comply wllh thaif employer'8 safoty and health policies/ procedures, and all applicable U.S. OocupntfoMI Safety and Health Administration (OSHA) rogulatlons • Including, but not limited to the applicablo sections of 29 CFA Part 1910 -Occupational Safety and Health Standards and 29 CFR Part 1926 -Safety and Health Regulations fol' Constructir.in. Personal prolaclive equipment (e.g. head protection, footwear, high visibility apparol, safely glasses, hearing prntecl1011, respirators, gloves, etc.) shall be worn as appropriate for the worlt being performed, and as specified in regulation. At a mlnhnum, all wo11mrs In tho State Highway tight of way, o:ccopt whon In their vohlclos, shall woar the following personal protective equipment: High visibility apparel as specified In the Traffic Control provisions of the documentation accompanying the Notice lo Proceed related to this permit (at a minimum, ANSl/tSEA 107-1999, class 2); head protection that compltos with the ANSI 289.1-1997 standard; and at all construction sites or whenever there is danger of injury to feel, workers shall comply with OSHA's PPE requirements fo1· foot protection per 29 CFR i 9·10.136, ·1926.95, and 1926.96. If required, such footwear shall moot the roqulromonts of ANSI 241-1999. Whero any o( the abovo,-ro1cronced ANSI standards havo borm revised, tho most recent version of the standard shall apply. 3-The Permittee Is l'esponsible tor complyh1g wilh the Revised Guidelines that have boen adopted by the Access Board under the American Disabilities Act (ADA). These guidelines define traversable slope requlr~ments and prescribe the use of a delined paltern of lruncalecf domes as delectable warnings Al street crossings. The new Standards Plans and can be found on the Doslgn and Construction Project Support web page at: J1ttps:l/www.codot.gov/business/civllrlqhts/ada/resoui-ces-engl11eers If an access permit is Issued to you, it will state the terms and conditions for its use. Any changes In the use of the permitted access not consistent with lhe terms and conditions listed on the permit may be considered a violalion or the permit. Tllo applicant doclnres under penalty of perjury in Ute secontl degree, and any other applicable state or federal laws, that All informaUon pro\llrlP.d on this fot·m r1nd suhmltfod ~ttachmants are to the hast nf their knowledge true .-nrl complete. I understand receipt of an nocess permit does not constitute permission to start access construction work. Dt,lo \ppllcant j Agent lor P _ -t/2 . " I II ,/;Jo/1_ J pticant Is not tho owner of the proporty, wo require this appl cation also to be signed b the property owner or 1 Ir J.6 gally authorlzod reprosontative (or other acceptable written evidence). This signature sKan oonstltute agreement with this appllcation by all owners-of-lntorost unloss stated In writing. If a permit Is Issued, the property owner. in most cases, will be listed as the permillee. Prlntnanic Dato /I ZS l(t Prevlouro ildlllons or(> l)b9olelo ond may not bo u:1011 P.ano 2 -012 coor Faun n 137 1211 o f-trz M l "1'-t:k, 32,QO 11 Garfield County lore Land Explorer ~OLJ~A (. Account R040368 Owner MMME WG LLC Physical Address Not available GLENWOOD SPRINGS 81601 p e"1a Mailing Address 6874 HIGHWAY 82 GLENWOOD SPRINGS. CO 81601 LANDSCAPE PLAN xx xxxxx xxx xxxxx xxxx xxx xxxxxx x5774 5786 5760 5 7 40 5730 5 7 4 0 57625 7 6 4 5 7 8 2 5 7 9 2 5780 5784 57805 7 7 0 5 7 6 0 5 7 5 0 Notes: 1. Riprap or cobble, Provide a one-pound sample of material for review and approval. 2. Warranty plants and trees for one year after final acceptance. Replace dead or dying materials not in vigorous, thriving condition as soon as weather permits. 3. Determine locations of underground utilities and perform work in a manner which will avoid possible damage. 4. Plants shall be specimen quality, typical of their species or variety. 5. Plant trees and shrubs in pits 12" larger than tree ball, backfill with a mix of 2 parts topsoil and 1 part Nutri-Mulch. 6. Install "Weed Restrictor Fabric" between soil and crushed granite or cobble. 7. Amend soil in perennial and shrub planting beds with 3 cubic yards of weed free compost for every 1,000 s.f. of planting bed. 8. Boulders shall be angular in shape, 1/2 ton to 1 ton in size. 9. All plant materials to be irrigated with a drip irrigation system. All seed or sod areas to be irrigated with an underground system utilizing rotating sprinkler nozzels. Revegetation notes All areas disturbed during construction will be revegetated according to the following criteria. During construction, erosion which may pose a threat to surrounding properties or waterways will be contained through the use of temporary erosion control measures as deemed necessary. Revegetation of disturbed areas shall commence in the fall, prior to the first major snowfall, or early spring when site conditions allow. Erosion Control measures are aimed at controlling/confining sediment within or near the area of disturbance. The long term stability of these areas will depend on the establishment of appropriate ground cover vegetation. The primary goal of the revegetation effort is to protect water quality that will require a sturdy ground cover as soon as possible. All natural vegetation to remain shall be protected. Exposure of soil to erosion by removal or disturbance of vegetation shall be limited to the area required for immediate construction operations and for the shortest practical period of time. All disturbed areas shall be seeded or covered with rip-rap. Use Rivendell's native low grow Pitkin County seed mix. All topsoil shall be salvaged from disturbed areas, stockpiled and re-spread prior to revegetation. Topsoil should not be re-spread on areas of the site proposed for future building. Seed shall be drilled or otherwise mechanically incorporated into the soil ("farmed") or shall be hydraulically applied and followed by application of hydraulically applied mulch or straw. Straw mulch shall be secured in place with a hydraulically applied tackifier. If at any time the contractor or civil engineer sees the site being unstable on the proposed slopes, erosion control mats will be placed to help stabilize the ground.Royal Mini Storage West GlenwoodGarfield County, Coloradodate: remarks: L1 20' Riprap or cobble buffer Limit of Disturbance Reseed all distrubed areas See revegetation notes Low Grow Seed Mix (Pitkin County Seed Mix) Rate: 1 lb per 1,000 sq. ft. 25% Slender Wheatgrass 20% Mountain Brome 20% Western Wheatgrass 20% Secar Bluebunch 5% Thickspike Wheatgrass 5% Idaho Fescue 3% Green Needle 2% Indian Ricegrass LANDSCAPE PLANAPRIL 8, 2022The LAND Studio 365 River Bend Way Glenwood Springs, CO 81601 970.927.3690 landstudio2@com cast.net Limit of Disturbance Reseed all distrubed areas See revegetation notes Limit of Disturbance Reseed all distrubed areas See revegetation notes If at any point the contractor sees the site being unstable on the proposed slopes, erosion control mats will be placed to help stabilize the ground.7.21.22 revisions/'\ . I \ I \ \ 1·~-\ \ ·<:·:-·/·.==-· /' .... : /· / ... -~tv:Lii-:lb·-'· '-1--1---Jl!!f f:;;;f,;J:;.;,;;}1;';{:';;;:~i;r:f::,; }ij!]~;;t;;·;):~;• /c' /•; <S · ,'C •·. -------·.,-.-::.:, . ----___ ..;. ~--'_; ·=:=:;-:::-:-::=:'\)i::/1:::i:----- :··: :··-·::-:::"·-:·:::::::L?:!:::, _ ..... ---- ----- SOPRIS ENGINEERING CIVIL PLAN SET 5780575 0 57 8 0 5750 5760 5770 57205730574057305720571057 3 0 57 2 0 5710 57405730 5770 5790 5780 5760 5770 5790 5800 57605770 57905800 5690 5690 5748 5746 574 4 5738 5764 5768 5770 57705760576057805800 5794 5784 5776 5794 5760 5770 5750 5790 5792 57 9 0 5798 57705746 5780 ue ueueueue ue ue ue ue ue ueueueoe oe oe oe oe oe oeoeBUREAU OF LAND MANGEMENT STORM KING HUNTING RANCH LLC REC. # 658533 RICHARD DEVER REC. # 570056 BURIED ELECTRICAL LINE30' ACCESS AND UTILITY EASEMENT 10' MTN STATES TELEPHONE EASEMENT ELECTRIC VAULT ELECTRIC TRANSFORMER 12X16' WELL BUILDING DEVER WELL #1 EXISTING LEECH FIELD EXISTING RESIDENTIAL STRUCTURE BURIED PROPANE TANK FIRE HYDRANT WELL BUILDING 12X13' DEVER WELL #3 30' ACCESS EASEMENT 14' POWERLINE EASMENT 18' POWERLINE EASEMENT PARCEL A 24.42 ACRES ± PARCEL B 14.48 ACRES ± AMICHAUX LIMITED PARTNERSIP LLLP HIGHWAY 6&24 INTERSTATE 70 WEST BOUND EXISTING CULVERT EXISTING CULVERT EXISTING CULVERT EXISTING CULVERT EXISTING CULVERT EXISTING CULVERT EXISTING CULVERT OVERHEAD ELECTRICAL LINE OPRIS ES NGINEERING, LLC. CIVIL CONSULTANTS 19137.01JOB NO. DATE: 502 MAIN STREET CARBONDALE, CO 81623 (970) 704-0311 FAX: (970)-704-0313 DESIGNED BY DRAWN BY CHECKED BY AD AD YN DATE REVISION C-1.0 DRAWING NO. TITLE G:\2019\19137\CIVIL\CIVIL DWGS\PLOT\LIMITED IMPACT REVIEW COMPLETLESS\19137 C1.0 EXISTING CON.DWG - Jul 28, 2022 - 7:36amNORTHEXISTING CONDTIONSROYAL MINI STORAGE AT CANYON TERRACESGARFIELD COUNTY, COLORADOLIMITED IMPACT REVIEW1 inch = ft. ( IN FEET ) GRAPHIC SCALE 075 75 150 75 30037.5 MEMBER UTILITIES FOR THE MARKING OF UNDERGROUND BEFORE YOU DIG, GRADE, OR EXCAVATE CALL 2-BUSINESS DAYS IN ADVANCE .QRZZKDW V 5 07-28-22 02/11/22 02/11/22 04/15/22 PROPERTY LINE PROPERTY LINE PROPERTY LINEPROPERTY LINE PROPERTY LINEPROPERTY LINEC below all before you· d' 19. ROWROWROWROWROWROWROWue ue ueueu e ue ue ue ue ue ue ue ue ueueueueueoe oe oe oe oe oe oe oe oeoexxxxxxxA1 A2 A3 A4 A5 A6 A7 OUTDOOR STORAGE EXISTING LEECH FIELD PROPERT Y L I N E PROPERTY LINE PROPERTY LINE PROPERTY LINE PROPERTY LINE PROPERTY LINEC1 C2 C3 C4 EMPLOYEE HOUSING OFFICE EXISTING HOME C5 B1 B2 B3 B4 B5 B6 B7 B8C2.130' ACCESS AND UTILITY EASEMENT BUREAU OF LAND MANGEMENT RICHARD DEVER REC. # 570056 BURIED ELECTRICAL LINE 10' MTN STATES TELEPHONE EASEMENT EXISTING ELECTRIC VAULT EXISTING ELECTRIC TRANSFORMER 12X16' WELL BUILDING DEVER WELL #1 EXISTING RESIDENTIAL STRUCTURE EXISTING BURIED PROPANE TANK EXISTING FIRE HYDRANT WELL BUILDING 12X13' DEVER WELL #3 30' ACCESS EASEMENT 14' POWERLINE EASMENT 18' POWERLINE EASEMENT PARCEL A 24.42 ACRES ± PARCEL B 14.48 ACRES ± HIGHWAY 6&24 INTERSTATE 70 WEST BOUND EXISTING CULVERT EXISTING CULVERT EXISTING CULVERT EXISTING CULVERT EXISTING CULVERT EXISTING CULVERT OVERHEAD ELECTRICAL LINE DEVER WELL #2 15' 10' MTN STATES TELEPHONE EASEMENT OPRIS ES NGINEERING, LLC. CIVIL CONSULTANTS 19137.01JOB NO. DATE: 502 MAIN STREET CARBONDALE, CO 81623 (970) 704-0311 FAX: (970)-704-0313 DESIGNED BY DRAWN BY CHECKED BY AD AD YN DATE REVISION C-2.0 DRAWING NO. TITLE G:\2019\19137\CIVIL\CIVIL DWGS\PLOT\LIMITED IMPACT REVIEW COMPLETLESS\19137 C2.0 SITE PLAN.DWG - Jul 28, 2022 - 7:24amNORTHOVERALL SITE PLANROYAL MINI STORAGE AT WEST GLENWOODGARFIELD COUNTY, COLORADOLIMITED IMPACT REVIEW1 inch = ft. ( IN FEET ) GRAPHIC SCALE 075 75 150 75 30037.5 MEMBER UTILITIES FOR THE MARKING OF UNDERGROUND BEFORE YOU DIG, GRADE, OR EXCAVATE CALL 2-BUSINESS DAYS IN ADVANCE .QRZZKDW V 5 SHT C2.3 SHT C2.2 SHT C2.4 SHT C2.1 07-28-22 02/11/22 02/11/22 07/22/22 N.T.S. ℄ 12' DRIVE LANE 8" OF CLASS 6 12' DRIVE LANE 12" CLASS 2 6' 1.5' 2:1 SLOPE 2:1 SLOPE 2% CROSS SLOPE N.T.S. AS SHOWN ON PLANS 5' MINIMUM OR N.T.S. 4" OF ASHPALT SHEET KEY PROPOSED ASPHALT PAVEMENT PROPOSED CONCRETE/SIDEWALK PROPOSED GRAVEL/ROAD BASE EXISTING SWALE OR DITCH>>>> PROPOSED FENCEx PROPOSED LEGEND 6" (TYPJ r 4000 PSI CONCRETE 2'6 CROSS SLOPE (TYP) TOW~DS ROAD. Cl..6 BASE COURSE CONTINUED FROM STREET. STRIP Afl TOP SOil AND a.AV, SCARIFY SUBGRAOE, RECOMPACTTO 95% MIN. STANDARD PROCTOR. CONCRETE DETAIL _l '" T --------== r, ____ 41r'--2.-0' ---I 6" 111/2" _1___ sr CONCRETE Cl6 BASE COURSE CONTINUED FROM STREET. STRIP ALL TOP SOIL AND CLAY, SCARIFY SU BG RADE, RECOMPACTTO 95% MJN. STANDARD PROCTOR. VALLEY PAN DETAIL 1 ASPHALTIC ROAD SECTION 1/C: ' I ~CJ I --~[i:L:@ .. • I ~- I ----~ ~ /" ---- below. Call before you dig. xx>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>> >>>>>>>>>>>>>>>>>>>>>>>>>>>>>>> >>>>>>>>>>>>>>>>>>>> x x xxxxxxx xxxxxPROPOSED SECURITY GATE OFFICE BUILDING EMPLOYEE HOUSING CARPORT SPACE FOR EMPLOYEE HOUSING PROPOSED FENCE BETWEEN BUILDINGS A1 A2 A3 A4 A5 A6 A7 HIGHWAY 6&24 R25' 200' 200' 240' 120' 120' 200' 200' 30' 40' 30' 23' 23' 23' 30' 40' 30' 40' 40' 36' 23' 24' 24' R20' R20' R5'R5' R25' 40' 40' 23' 23' 12' 17' BASIN 3C BASIN 3D OPRIS ES NGINEERING, LLC. CIVIL CONSULTANTS 19137.01JOB NO. DATE: 502 MAIN STREET CARBONDALE, CO 81623 (970) 704-0311 FAX: (970)-704-0313 DESIGNED BY DRAWN BY CHECKED BY AD AD YN DATE REVISION C-2.1 DRAWING NO. TITLE G:\2019\19137\CIVIL\CIVIL DWGS\PLOT\LIMITED IMPACT REVIEW COMPLETLESS\19137 C2.0 SITE PLAN.DWG - Jul 28, 2022 - 7:29amNORTHSITE PLAN PHASE 1ROYAL MINI STORAGE AT WEST GLENWOODGARFIELD COUNTY, COLORADOLIMITED IMPACT REVIEW1 inch = ft. ( IN FEET ) GRAPHIC SCALE 020 20 40 20 8010 MEMBER UTILITIES FOR THE MARKING OF UNDERGROUND BEFORE YOU DIG, GRADE, OR EXCAVATE CALL 2-BUSINESS DAYS IN ADVANCE .QRZZKDW V 5 SHT C2.3 SHT C2.2 SHT C2.4 40' 30' 07-28-22 02/11/22 02/11/22 07/22/22 3' VALLEY PAN (TYP) SWALE (TYP) PROPOSED ASPHALT PAVEMENT PROPOSED CONCRETE/SIDEWALK PROPOSED GRAVEL/ROAD BASE EXISTING SWALE OR DITCH>>>> PROPOSED FENCEx SHEET KEY PROPOSED LEGEND I / - I I I I I I I I / / I I I \ / / / / • A • I / - • ' 4 • / / / / / '.2!-:::Js;;;_<,~}'~;y / / / I • 1171 ~ • 4 • • • • , , • , 4 • ., • • I / • • • , , • • •· , • 4 • , • , 4 • , • • • 4 4 • 4 • • 4 • • • 4. 4 • • • I l I I I \ \ I I I I '----- • 4 • ., • I • I I • . 4 • • • \ \ - , • • • • • , • • , , , • 4 4 . , • • • 4 .. • -- ( I I I I I I .. - , - ' , 4 ----- - 4 ' • 4 --- ' ---; - 4 • 4 • • 4 ---- 4 • 4 • ---- -- 4 " • 4 • d , 4 • • , 4 • <1 "4· • , . • , ------------- • • 4 4 1 4 I 4 , --- • • • 0 4 • , • 4 rur, 4 , , • • below. Call before you dig. HWY 6 >>>>>>>>>>>>>>> >>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>> > > > > > > >>>>>>>>>>>x x x xxxxxxxxxPROPERTY LINE PROPERTY LINE200' 200' 160' 160' 200' 40' 40' 23' 23' 23' 30' 40' 40' 30' 40' 40' 40' 40' 40' 40' 30' 200' 200' 200' 3' VALLEY PAN 3' VALLEY PAN 3' VALLEY PAN B1 B2 B3 B4 B5 B6 B7 B8 SWALE (TYP) FENCE BETWEEN BUILDINGS (TYP) STORM WATER DETENTION OPRIS ES NGINEERING, LLC. CIVIL CONSULTANTS 19137.01JOB NO. DATE: 502 MAIN STREET CARBONDALE, CO 81623 (970) 704-0311 FAX: (970)-704-0313 DESIGNED BY DRAWN BY CHECKED BY AD AD YN DATE REVISION C-2.2 DRAWING NO. TITLE G:\2019\19137\CIVIL\CIVIL DWGS\PLOT\LIMITED IMPACT REVIEW COMPLETLESS\19137 C2.0 SITE PLAN.DWG - Jul 28, 2022 - 7:30amNORTHSITE PLAN PHASE 2ROYAL MINI STORAGE AT WEST GLENWOODGARFIELD COUNTY, COLORADOLIMITED IMPACT REVIEW1 inch = ft. ( IN FEET ) GRAPHIC SCALE 020 20 40 20 8010 MEMBER UTILITIES FOR THE MARKING OF UNDERGROUND BEFORE YOU DIG, GRADE, OR EXCAVATE CALL 2-BUSINESS DAYS IN ADVANCE .QRZZKDW V 5 SHT C2.3 SHT C2.1 SHT C2.4 07-28-22 02/11/22 02/11/22 07/22/22 PROPOSED ASPHALT PAVEMENT PROPOSED CONCRETE/SIDEWALK PROPOSED GRAVEL/ROAD BASE EXISTING SWALE OR DITCH>>>> PROPOSED FENCEx SHEET KEY PROPOSED LEGEND 0 I» -CJ" I ~er cil !!!. '<0 g :E C. a:, I I I I I I I I I I I I I I I I ' I ' I ' I ' I ' I ' I ' I ' I ' I ' t-------+--L-,-_J I lV ~ " i? . . ·.\ \· . . . i:---r.-----.,------J . b. tr. K. "' . "" •• \ ' I • _I • .• • b • ',;,. • • . b o • • • ' • • • •. 1 ~: . b • " . ·,. " . • • • • .. . ' • b • • ~ • " •• • • b /\\•• . • .· • I ,\ ~ " • • .. •' • • I • . " . • • I • . • • . . /,I>~ • • • • • • • • . .. I I 1-• I I I I I ' • • .. " . • 4 • • • • • • • " • b • ·• • • • • b • . : • • • • • • . .. . . • " b I• •I • • • • • I • • ' . . •• • " • • r . . . • • • • • • • .. :/;> • " • • • • <>i,,." • b •• • . . • • . • • b • • • •• . • • ·1 I • • • " I • • • • ' . b • • . • •• ' • i ... ,.· • . . . . . . ,.·_,;,_ . . • .. • •• ' • . • • , . ' • I • • • • • • ... • • • • • • • • . 1 I I • • • ·• • ' b b . . • ~ . • • • • • • •• • b .. b • • ·r • • . . • . . . " 4,. 1::,.· ,. • • b b • [-~ • r;:-I-,,-' • • • b. .. ,. • • • .. • • • • •• • • .. • . . • • " • • •• • ' I:,, .,. .. • . " ~~ i .. •• • • • • • • b • • • • b • • . . . • b • •I . . . • • • •• . • . • ·' . • • .. ·1:,..-. • • • . ,;; • I I I I I ·. •" • • • •-. ·~ I •J, .. ··~,1 • • • t • • • • • I b • . •• • • • . • • • • • • • • • ·' • b • • • • • ·, • • ·• • • • • •• • • • • " •. • b • • • . • ,.. " • • • ,, • ,,. ... • "' i • • • • • ,. I . ·1-----1 • • r:;: •· , • :~ l::.. " • ' l-• • • • • . . • ' • \ I I I I I I I I I I I I I I I I I I I I • • I • ·1-------t, • • ' I I I I I I I •• b • • • l::.. ..... • • •• • . • . . •• • • . • • • • • • • I • b • • •• b • . . • •• • • • • • t •• " . . • '• • • • • • • . . • . • • • • .. • • • • •• • ' • • •· • • ./> • I [j l--i---:---::-'""--0:,· . •. I•• • ·, • • • b • •• ·, b • • • • b • .. , l v-G. "' I::.. .. .. "' • • • . . • • •• • • • • • • • ... I> • • • " • • • " • • • . l::..'-i,. • •• • • •• • • • •• i:;: .. • • • •• •• • ~ "\ t:,. .. • • • ·• . • • /;.. .. "' • ~ • • • • • • ' b • • . b • . • • • • t .~ • • .. b ' • • • ·' . .. • • • b .. .. ,, ,,. • • < • • ·, . • ~ • b ·, • • • • • • • • .. "-t,. • lo • ' . .. • • " • •, • • • • " • • • • ,. .. c:,. • " .. • ·1 Ill ,. .. ,. b. ~ ,. I. • ~ r,." • • • • • • • • ,I • . • • • ~-!',,. • • • ·• • I 1, l· ·. t--r:. • • i-;i;-• • • • • • ·~ • It . • . .. •. • • • • d b • • " ' • •I • •, • • • • '· b • .. • .. b • • . . • • P,_ .. • • ~ . .. • • I> . • • ' • • " . • .. • ' " . . ~-----i • . . • • ' • • ·' ~ . • • •' . • • • • • • •I ' • • • • • • • • • • • • "' .-~,. • I A -· •• • • ~ ~ ,. • &I ~ • '• I • • ,, .. • • • •I • • I • ~ •, ; . ,. . . • • . "' ' • • • ' • . ' • •• • • • • " • • • . • ~ ·1-----1 ~ ,· • 1' • • b .. 1•" • • • ,1 • b I • " . •• ~ •• • • • •• • ~. \...-----7.: • • ' • • • " • • I , . I • • • . • • • ., • t,. -... • • • ·., • . ----t • • • I • ' '--'-· t===~-::--r-----.--~~ . • C-----~-------'..J.,,-. ,. .. ~-.. ~ . . • • • • • • "• . . • • .. • • • • • • • ' ·, '• • • • • • . .• ,. ... • • .. • • • •• • • '• • • . b '-'' • • • .•. • ~ . • •• • . . • •·· • .. .. . ' • •• • • • • • • • • • • • r I • • • • • •• • ~· • . . • • • • • ----/ • ... IS. • • , . • • • • • • • • , . •• .. • • •• • ~ ··"' • • • " •• . . . • I:),~ •• . . • • • • • • • • • t • " . ~ • • • • • • • • .. • " , .. • • • '-•. ... ,.. • • •'> • -" \ / I ) I \ '-... ----_____ _,,,, -/ / / / -------------------------------------------/ / I I I I I I I ~ I \' I, ~ >>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>> >xUEUEUEUEUExxxxxxxxxxxxx xxxxxxxR20' R20' PROPERTY LINE PROPERTY LINE PROPERTY LINE C1 C2 C3 C4 C5 280' 280' 240' 40' 40' 160' 160' 40' 30' 30' 40' 40' R20' R20' 23' 23' 23' DEBRIS BASIN 2 40' 40' 3' VALLEY PAN (TYP) R20' R20' 24' 24' FENCE (TYP) OPRIS ES NGINEERING, LLC. CIVIL CONSULTANTS 19137.01JOB NO. DATE: 502 MAIN STREET CARBONDALE, CO 81623 (970) 704-0311 FAX: (970)-704-0313 DESIGNED BY DRAWN BY CHECKED BY AD AD YN DATE REVISION C-2.3 DRAWING NO. TITLE G:\2019\19137\CIVIL\CIVIL DWGS\PLOT\LIMITED IMPACT REVIEW COMPLETLESS\19137 C2.0 SITE PLAN.DWG - Jul 28, 2022 - 7:32amNORTHSITE PLAN PHASE 3ROYAL MINI STORAGE AT WEST GLENWOODGARFIELD COUNTY, COLORADOLIMITED IMPACT REVIEW1 inch = ft. ( IN FEET ) GRAPHIC SCALE 020 20 40 20 8010 MEMBER UTILITIES FOR THE MARKING OF UNDERGROUND BEFORE YOU DIG, GRADE, OR EXCAVATE CALL 2-BUSINESS DAYS IN ADVANCE .QRZZKDW V 5 SHT C2.1 SHT C2.4 SHT C2.2 04-15-22 02/11/22 02/11/22 04/15/22 SWALE (TYP) PROPOSED ASPHALT PAVEMENT PROPOSED CONCRETE/SIDEWALK PROPOSED GRAVEL/ROAD BASE EXISTING SWALE OR DITCH>>>> PROPOSED FENCEx SHEET KEY PROPOSED LEGEND .. • ·• • • 4 • . • • • • • • • • ,,. .., <l .. • • • • • / I \ \. -------- ----------- ~ == ---• . • • • • • ""· ,l .i • • , ' • • • « • • .1-... ...:·;·-"•...:-...:-----;•:.,,-----... -~--------·-·:...-.:--'----... --·:...---.:-----"'...:'::...--.:-------'-"'"---' ._ ... _______ ·:... ... .:..---...:·,·---..;.·-..---'-------_.,-..;.•.:..-..::------."'---;...---... --,.,.:.---"-'--------1 , ----'.=:::.:::.=::::.:.::•:..:~-:....:::-:...--',.:.L--•:;..· :...-------~•_;_:_._,..._...::..---...::....------'-""--~•-------...:---...:.:---'-'-...,._. ... -'---'..:----;;.....:...: ... ---''..--------..:-----'-""" ___ ..,,...----...:::....--'--'-----"--'''--i .. ., . ..,· • • • 4 4 • • • • 4 • • • J • • ' • • • • N • • • • • .• . • • • 4 •• . .,_ .. • • 4 .. • • • . 4 • • --------------- - ( \ \ ) ---------r------------------ I • • • • • • A . . • . ., .. • • • • A • • • ' ' • • 4 4 • . ' --- • • • rr,r, ------------- • • • • • i.....:·:.· ;...J..-1---· A • • ' • • ' • • • \ \\ \ \ \ • ..----- C below all before you· d' 19. xxxOUTDOOR STORAGE EXISTING LEECH FIELD EXISTING PROPANE TANK R25' R10' R20'R25' R20' R25' 278' 188' 10' 20' 20' 40' 24' PROPERT Y L I N E R20' DEBRIS BASIN 1 PROPOSED WALL FOR ROCKFALL MITIGATION EXISTING DRY HYDRANT DEBRIS BASIN 1 EXISTING HOUSE OPRIS ES NGINEERING, LLC. CIVIL CONSULTANTS 19137.01JOB NO. DATE:07-28-22 502 MAIN STREET CARBONDALE, CO 81623 (970) 704-0311 FAX: (970)-704-0313 DESIGNED BY DRAWN BY CHECKED BY AD 02/11/22 AD 02/11/22 YN 07/22/22 DATE REVISION C-2.4 DRAWING NO. TITLE G:\2019\19137\CIVIL\CIVIL DWGS\PLOT\LIMITED IMPACT REVIEW COMPLETLESS\19137 C2.0 SITE PLAN.DWG - Jul 28, 2022 - 7:33amNORTHSITE PLAN OUTDOOR STORAGEROYAL MINI STORAGE AT WEST GLENWOODGARFIELD COUNTY, COLORADOLIMITED IMPACT REVIEW1 inch = ft. ( IN FEET ) GRAPHIC SCALE 020 20 40 20 8010 MEMBER UTILITIES FOR THE MARKING OF UNDERGROUND BEFORE YOU DIG, GRADE, OR EXCAVATE CALL 2-BUSINESS DAYS IN ADVANCE .QRZZKDW V 5 SHT C2.3 SHT C2.1 SHT C2.2 30% SLOPE LINE PROPOSED ASPHALT PAVEMENT PROPOSED CONCRETE/SIDEWALK PROPOSED GRAVEL/ROAD BASE EXISTING SWALE OR DITCH>>>> PROPOSED FENCEx SHEET KEY PROPOSED LEGEND \ ' g:;¢1 I n uJ r:a:tPJ ' ---::--=----~-=---- \ 0 _/ - ® -........ ......__ ......__ I<: '~·',?/, t::{;:,',':~;.~ <~:-~:y;:' !Y/{;}:_-.;t ·. ;:~.~A IEEEEE E ~ I I I I I below. ~ ----~~~ Callbeforeyoudig. xxxxxxxA1 A2 A3 A4 A5 A6 A7 OUTDOOR STORAGE EXISTING LEECH FIELD EXISTING WELL PROPERT Y L I N E PROPERTY LINE PROPERTY LINE PROPERTY LINE PROPERTY LINE PROPERTY LINEC1 C2 C3 C4 EMPLOYEE HOUSING OFFICE EXISTING HOME WESTBOUND INTERSTATE 70 HIGHWAY 6&24 C5 B1 B2 B3 B4 B5 B6 B7 B8C2.1OPRISESNGINEERING, LLC. CIVIL CONSULTANTS 19137.01JOB NO. DATE: 502 MAIN STREET CARBONDALE, CO 81623 (970) 704-0311 FAX: (970)-704-0313 DESIGNED BY DRAWN BY CHECKED BY AD AD YN DATE REVISION C-2.5 DRAWING NO. TITLE G:\2019\19137\CIVIL\CIVIL DWGS\PLOT\LIMITED IMPACT REVIEW COMPLETLESS\19137 C2.0 SITE PLAN SNOW.DWG - Jul 28, 2022 - 7:35amNORTHOVERALL SNOW STORAGE PLANROYAL MINI STORAGE AT WEST GLENWOODGARFIELD COUNTY, COLORADOLIMITED IMPACT REVIEW1 inch = ft. ( IN FEET ) GRAPHIC SCALE 075 75 150 75 30037.5 MEMBER UTILITIES FOR THE MARKING OF UNDERGROUND BEFORE YOU DIG, GRADE, OR EXCAVATE CALL 2-BUSINESS DAYS IN ADVANCE .QRZZKDW V 5 07-28-22 02/11/22 02/11/22 07/22/22 SNOW STORAGE REQUIRED: PHASE 1 & 2: 1,817 SF PHASE 3: 1,076 SF OUTDOOR STORAGE: 1,216 SF ENTRANCE: 497 SF TOTAL: 4,606 SF SNOW STORAGE PROVIDED: PHASE 1 & 2: 1,968 SF PHASE 3: 3,796 SF OUTDOOR STORAGE: 5,290 SF ENTRANCE: 5,070 SF TOTAL: 16,124 SF SNOW STORAGE -----.... --r--r11~CI~r -~~-=-~-:J-r-t7--i o. \ -- below. Call before you dig. xxxxxxxA1 A2 A3 A4 A5 A6 A7 OUTDOOR STORAGE EXISTING LEECH FIELD EXISTING WELL PROPERT Y L I N E PROPERTY LINE PROPERTY LINE PROPERTY LINE PROPERTY LINE PROPERTY LINEC1 C2 C3 C4 EMPLOYEE HOUSING OFFICE EXISTING HOME WESTBOUND INTERSTATE 70 HIGHWAY 6&24 C5 B1 B2 B3 B4 B5 B6 B7 B8 :45.0Steering Angle 7.08 21.38 9.68 6.91 6.0 GWS FIRE feet : : : Width Track Lock to Lock Time 35.54 OPRIS ES NGINEERING, LLC. CIVIL CONSULTANTS 19137.01JOB NO. DATE: 502 MAIN STREET CARBONDALE, CO 81623 (970) 704-0311 FAX: (970)-704-0313 DESIGNED BY DRAWN BY CHECKED BY AD AD YN DATE REVISION C-2.6 DRAWING NO. TITLE G:\2019\19137\CIVIL\CIVIL DWGS\PLOT\LIMITED IMPACT REVIEW COMPLETLESS\19137 C2.0 FIRE TRUCK TURNING MOVEMENTS.DWG - Jul 28, 2022 - 7:40amNORTHFIRE TRUCK TURNING MOVEMENTSROYAL MINI STORAGE AT WEST GLENWOODGARFIELD COUNTY, COLORADOLIMITED IMPACT REVIEW1 inch = ft. ( IN FEET ) GRAPHIC SCALE 075 75 150 75 30037.5 MEMBER UTILITIES FOR THE MARKING OF UNDERGROUND BEFORE YOU DIG, GRADE, OR EXCAVATE CALL 2-BUSINESS DAYS IN ADVANCE .QRZZKDW V 5 07-28-22 02/11/22 02/11/22 07/22/22 PROPOSED ASPHALT PAVEMENT PROPOSED CONCRETE/SIDEWALK PROPOSED GRAVEL/ROAD BASE EXISTING SWALE OR DITCH>>>> PROPOSED FENCEx PROPOSED LEGEND --- -~- C below all before you· d" 19. oe oe oe oe oe oe oe oe oeoeUEUEUEUEUEUExxxxxxxA1 A2 A3 A4 A5 A6 A7 B1 B2 B3 B4 B5 B6 B7 B8 PROPOSED DETENTION POND EXISTING LEECH FIELD EXISTING WELL C1 C2 C3 C4 OUTDOOR STORAGE EMPLOYEE HOUSING OFFICEEXISTING HOME WESTBOUND INTERSTATE 70 HIGHWAY 6&24 C5 OPRIS ES NGINEERING, LLC. CIVIL CONSULTANTS 19137.01JOB NO. DATE:07-28-22 502 MAIN STREET CARBONDALE, CO 81623 (970) 704-0311 FAX: (970)-704-0313 DESIGNED BY DRAWN BY CHECKED BY AD 01/28/22 AD 01/28/22 YN 07/22/22 DATE REVISION C-3.0 DRAWING NO. TITLE G:\2019\19137\CIVIL\CIVIL DWGS\PLOT\LIMITED IMPACT REVIEW COMPLETLESS\19137 C3.0 GRADING.DWG - Jul 28, 2022 - 12:39pmNORTHOVERALL GRADING PLANROYAL MINI STORAGE AT WEST GLENWOODGARFIELD COUNTY, COLORADOLIMITED IMPACT REVIEW1 inch = ft. ( IN FEET ) GRAPHIC SCALE 075 75 150 75 30037.5 MEMBER UTILITIES FOR THE MARKING OF UNDERGROUND BEFORE YOU DIG, GRADE, OR EXCAVATE CALL 2-BUSINESS DAYS IN ADVANCE .QRZZKDW V 5 3a 3b 3c 3d 2 SHT C2.3 SHT C2.2 SHT C2.4 SHEET KEY ' 0 I ' • r 111rru ' ~C!j\ --,~:u,u• l (-~ -,~-.-~- ~ 1/ [._.-----~ ; ,,.......'-...--_ ---..... --- below. Call before you dig. xx>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>> >>>>>>>>>>>>>>>>>>>>>>>>>>>>>>> >>>>>>>>>>>>>>>>>>>> x x xxxxxxx xxxxx5770 5790 5780 5770576057805800 5794 5770PROPOSED SECURITY GATE OFFICE BUILDING EMPLOYEE HOUSING CARPORT SPACE FOR EMPLOYEE HOUSING A1 A2 A3 A4 A5 A6 A7 HIGHWAY 6&24 FFE:5775.30' FFE:5774.80' FFE:5774.30'FFE:5773.80' FFE:5773.30' FFE:5775.30'FFE:5774.80'FFE:5774.30' FFE:5773.80'FFE:5773.30' FFE:5773.30'FFE:5773.80'FFE:5774.30'FFE:5774.80' FFE:5775.30'FFE:5775.82' FFE:5772.50' FFE:5771.50'FFE:5771.00'FFE:5770.50' FFE:5772.50' FFE:5772.00' FFE:5771.50' FFE:5771.00'FFE:5770.50' FFE:5772.64' FFE:5772.00' FFE:5771.50'FFE:5771.00' FFE:5770.55' FFE:5771.51' FFE:5771.04' FFE:5770.59' 1.0% 1.0% 1.0% 1.0% 1.0% 1.1% 1.0% 2.5% 2.5% 2.5% 2.3%57701.0% 1.0% 1.0% 1.0%1.0%2.0%-2.7:1-2.2:1-2.2:1-2.1:1-2.2:1-2 .3 :1-2.0:1-2 .0 :1-1.6:15760 5750 57 9 6 58 0 0 5804 5794 577457725780 57781.0%2.1%1.0%6.7% 6.7%0.1%6.7%0.0%1.0%1.3% 2.0% RIM:5774.24' RIM:5774.93' RIM:5774.37' RIM:5773.57' RIM:5773.30' RIM:5772.44' RIM:5772.11' RIM:5772.29' RIM:5771.60' RIM:5770.71' RIM:5771.37' RIM:5770.63' RIM:5770.61' RIM:5771.37'57605750577057765.5%5.7%7.8%0.2%5.8%0.0%1.0%1.0%1.0%1.0%1.0%1.0%3.1% 3.1% 2.1% DAYLIGHT: 5750.25' RIM:5775.17' RIM:5775.17' INV IN: 5794' INV OUT: 5774' INV IN: 5764.5094 LF OF 60" ADS N-12 SMOOTH WALLED PIPE @ 20.9%210 LF OF 60" ADS N-12 SMOOTH WALLED PIPE @ 6.8%12.0%10.7%3.7% 3.0% 5.5% 2.9% RIM:5771.09' 3.5% 3.8% 4.2% 1.0% 1.0%57705780 5790 5800 5780 5770 5780 5790 5800 581058105770 OPRIS ES NGINEERING, LLC. CIVIL CONSULTANTS 19137.01JOB NO. DATE:07-28-22 502 MAIN STREET CARBONDALE, CO 81623 (970) 704-0311 FAX: (970)-704-0313 DESIGNED BY DRAWN BY CHECKED BY AD 01/28/22 AD 01/28/22 YN 07/22/22 DATE REVISION C-3.1 DRAWING NO. TITLE G:\2019\19137\CIVIL\CIVIL DWGS\PLOT\LIMITED IMPACT REVIEW COMPLETLESS\19137 C3.0 GRADING.DWG - Jul 28, 2022 - 12:36pmNORTHGRADING AND EROSION CONTROL PLANROYAL MINI STORAGE AT WEST GLENWOODGARFIELD COUNTY, COLORADOLIMITED IMPACT REVIEW1 inch = ft. ( IN FEET ) GRAPHIC SCALE 020 20 40 20 8010 MEMBER UTILITIES FOR THE MARKING OF UNDERGROUND BEFORE YOU DIG, GRADE, OR EXCAVATE CALL 2-BUSINESS DAYS IN ADVANCE .QRZZKDW V 5 SHT C2.3 SHT C2.2 SHT C2.4 30% SLOPE LINE SHEET KEY I / I / / / / / / ----- -- / I / / - - I I / / / / I 1 ---'-I- l-t-- / I \ --- / / -- I 7 / \ \ \ \ \ 1/1 /1 I I I I I I i /;1 1 I I I I I ) I I I ;I 1 I I ,1 1 I I ________ __....,.,,,.. /I I ------- ---------- / / / \ \ I I I ~---"~------'".°"\ _____ II ---,,.:./::___ / " ------/ ( I I \ I / I I I / I I I I I I / I / I / / / I I / / / / / I / ---- / I / / I / I ----- . /. . / / I I I I / / • I I / / I / • / ✓----_ __., I .,.,,,,.----/ 1 =~\=j '-..=:=;;:::::-;;;;=---~:::=::===s~~="==-~=/=/:==-=-==~:::=:/=:~\-~~;J,'-..~---_/--~~/.;;;..:.,,,~,,,::-1..,,,:::.~~,~'"::"'~--=======t\~-~~=~=,,..:::/::::- I I 0 • - • - • / "./ • below. Call before you dig. >>>>>>>>>>>>>>> >>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>> > > > > > > >>>>>>>>>>>x x x xxxxxxxxx5750 5760 5770 574057405730 5748 5746 574 4 5738 5764 5768 5770 576057605746 5780 B1 B2 B3 B4 B5 B6 B7 B8 PROPOSED DETENTION POND PROPERTY LINE PROPERTY LINEFFE:5770.55' FFE:5770.59' 2.5% 2.5% 2.3% FFE:5769.92'FFE:5769.20'FFE:5768.70' FFE:5768.20' FFE:5767.70' FFE:5766.90'FFE:5766.40' FFE:5765.90'FFE:5765.40' FFE:5764.90' FFE:5765.40'FFE:5765.90'FFE:5766.40' FFE:5766.90' FFE:5767.70' FFE:5768.20' FFE:5768.70' FFE:5769.20' FFE:5769.70' FFE:5769.70'FFE:5769.20' FFE:5768.70' FFE:5768.20' FFE:5767.70' FFE:5766.90' FFE:5766.40' FFE:5765.90'FFE:5765.40' FFE:5766.90'FFE:5766.40' FFE:5765.90'FFE:5765.40' FFE:5764.90' FFE:5769.70'FFE:5769.20' FFE:5768.70' FFE:5768.20' FFE:5767.70'57705750 57405768 576657605764 1.0% 2.5% 2.5% 2.5% 1.0% 1.0% 1.0% 1.0% 1.1%1.0%1.0%1.0% 1.0%1.0%1.0%1.0%1.0%1.0%1.0%1.0%1.1%1.1%1.0% 1.0%1.0%1.0% 1.0%1.0%1.0%1.0%1.0%1.0%1.0%1.0%2.0% 2.0% 2.0%0.0%-2.1:1-2.1:1-2.1:1-2.0:1-2.1:1 -2.5:1 -1 .4 :1-2.0:1-2.0:1RIM:5769.67' RIM:5769.29' RIM:5769.67' RIM:5769.29' RIM:5769.67' RIM:5768.69' RIM:5767.88' RIM:5766.75' RIM:5765.83' RIM:5764.78' RIM:5764.87' RIM:5764.87' RIM:5765.88'RIM:5766.69' RIM:5767.88' RIM:5768.67' RIM:5768.69' RIM:5767.88' RIM:5766.48' RIM:5766.63' RIM:5766.49' RIM:5765.88' 5770 5776 576857665766 5760575057405760 5750 5740 5730 576057705780 5 7 5 0 5 7 60 5 7 7 0 5 7 8 0 5760577057805760 - 2 . 0 : 1 -2.0:1-2.0:1-2.0:1- 2 . 0 : 1 4.0 %8.4%8.3%8.0%4.0% OPRIS ES NGINEERING, LLC. CIVIL CONSULTANTS 19137.01JOB NO. DATE:07-28-22 502 MAIN STREET CARBONDALE, CO 81623 (970) 704-0311 FAX: (970)-704-0313 DESIGNED BY DRAWN BY CHECKED BY AD 01/28/22 AD 01/28/22 YN 07/22/22 DATE REVISION C-3.2 DRAWING NO. TITLE G:\2019\19137\CIVIL\CIVIL DWGS\PLOT\LIMITED IMPACT REVIEW COMPLETLESS\19137 C3.0 GRADING.DWG - Jul 28, 2022 - 12:27pmNORTHGRADING PLANROYAL MINI STORAGE AT WEST GLENWOODGARFIELD COUNTY, COLORADOLIMITED IMPACT REVIEW1 inch = ft. ( IN FEET ) GRAPHIC SCALE 020 20 40 20 8010 MEMBER UTILITIES FOR THE MARKING OF UNDERGROUND BEFORE YOU DIG, GRADE, OR EXCAVATE CALL 2-BUSINESS DAYS IN ADVANCE .QRZZKDW V 5 SHT C2.3 SHT C2.1 SHT C2.4 EXISTING WELL EXISTING 30% SLOPE LINE SHEET KEY / • / / / / / I-,-~-' ;{" 4 • I I I I \ \ ( 4 • ( / • 4 • ' • / • / ./ .. ' • / /\ '-!. ",& ----.,\ I, ----------- ~--- / ----- . / ' / • / .I I / ' . . 4 / / / / / / / / / / / / / • / I I l • \ / / / • / / / I .,; .. I , I / / / • / / / / / / / / / I / / \ I _.,) / . • / -~.:::--------~ -~---=----------- --- / / I I I I I ) / / / I / / / / / / / / I / / I / / ' ( ( / I / / / / / / • / / / I / / ✓- / / / / -/ I I / / ,,--- j ' / / I \ I / •✓ .<'.!_,.....-. I I I . ' / .. .<'.I / . I I I , I I I / / 0M --:::::-.-,,;::c_ _________ ,---------- / / / / ' • I / -I / I ;--; -/,-"-. \_/ \ ·, ;.,-A ~ ., / <I , <! ,> d I ~ ' ' \ \ / / I / I I / I I ' I / / / I 4 /' ( I / ' ' / / • ... /" ·. . / ..... "· . / / / I / / I _j I I I ( ' \ I I \/ • ---- \ • I I • I / ' • . ' • .<l"•'· ---· ----:... .,.,,... --. <l I / ' I / -/ I 1/ I ' \ \ \ \ \ \ \ .; .<'.I <f .. --------......... \ \ \ -r \ ' \ \ \ \ \ \ \ \ \ \ ""- \_ \ \ \ "" / i J \ ' - ___ , I I ----- / I I / / v \ \ \ \ below. Call before you dig. >>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>> >>xxxxxxxxxxx xxxxxx57 8 0 5760 5770 5790 5800 5784 5776 5794 5760 5770 5750 5790 5792 57 9 0 5798 R20' PROPERTY LINE PROPERTY LINE PROPERTY LINE C1 C2 C3 C4-2.1:1-2.0:1-2.0:1-2.0:1-2.0:1-2.6:10.9% 1.1% 1.0% 1.1% 1.0% 1.0%1.0%1.6% 1.7%1.1%FFE:5765.83' FFE:5766.46' FFE:5773.45' FFE:5773.95' FFE:5774.45' FFE:5774.95' FFE:5774.45' FFE:5773.95' FFE:5773.45' FFE:5772.95' FFE:5770.16' FFE:5769.67' FFE:5769.16'FFE:5768.66' FFE:5768.16' FFE:5768.26' FFE:5768.76' FFE:5769.26' FFE:5769.76' FFE:5770.26' FFE:5767.76' FFE:5768.26' FFE:5768.76' FFE:5769.26' FFE:5769.76' FFE:5770.26' C5 -2.8:1-2.8:1-2.6:1-2.3:16.5%57 8 0 57745770 5760 5760577057681.0% RIM:5771.26' RIM:5773.06' RIM:5774.33' RIM:5774.26' RIM:5770.73' RIM:5770.34' RIM:5769.15' RIM:5768.35' RIM:5767.80' RIM:5768.55' RIM:5769.44' RIM:5770.37' FFE:5770.76' FFE:5770.76' FFE:5770.66' FFE:5771.16' 2.9% 5800 5790 5780 5770 57 7 0 5780 5790 5800 5770 5780 5790 5800 5770576857705770 5766 5762 5762 5766 577457 7 8 57765776 5770 5766 5762 5764 5770 5766 5762 5758 5756 5754 5752 5750 5748 5746 RIM:5770.81' 1.0% 2.1% 1.0% 2.9%0.0%1.0%1.0%1.0%0.9%1.7%1.0%1.0%1.0% 1.0%1.0%2.1%1.0%1.0% 1.0% 6.6% 5.3%1.0%2.1% 1.0%1.0%1.0%5764 5760 5756 5752 5768 HWY 6 I-70 I-70 EMPTY FIBER CONDUITS OPRIS ES NGINEERING, LLC. CIVIL CONSULTANTS 19137.01JOB NO. DATE:07-28-22 502 MAIN STREET CARBONDALE, CO 81623 (970) 704-0311 FAX: (970)-704-0313 DESIGNED BY DRAWN BY CHECKED BY AD 01/28/22 AD 01/28/22 YN 07/22/22 DATE REVISION C-3.3 DRAWING NO. TITLE G:\2019\19137\CIVIL\CIVIL DWGS\PLOT\LIMITED IMPACT REVIEW COMPLETLESS\19137 C3.0 GRADING.DWG - Jul 28, 2022 - 7:45amNORTHGRADING & EROSION CONTROL PLANROYAL MINI STORAGE AT WEST GLENWOODGARFIELD COUNTY, COLORADOLIMITED IMPACT REVIEW1 inch = ft. ( IN FEET ) GRAPHIC SCALE 020 20 40 20 8010 MEMBER UTILITIES FOR THE MARKING OF UNDERGROUND BEFORE YOU DIG, GRADE, OR EXCAVATE CALL 2-BUSINESS DAYS IN ADVANCE .QRZZKDW V 5 SHT C2.1 SHT C2.4 SHT C2.2 DAYLIGHT: 5745.3' ± INV: 5776.76' 12" ADS N-12 SECURITY GATE INV IN: 5761.37'170LF OF 60" ADS N-12 SMOOTHED WALL PIPE @ 9.29%SHEET KEY . .,. 4 . • • -------- _I ---- • • • • • ___ ------.E ~ --'--""'-... 7' • \ I ,,..,..---------- / \ \ \ \ ~ ' \ ' -------~ / / -- • --------------- -- '-- r I / / / -.=-,...;;:-.;;,:;_ ~ ---~ __________ / -------- ------- / I I / ---- r I \ I ' ' I 1 ) \ ----------- -------- I I \ I /' / I I ' / '-- 1 ~ I r I I \ I / r I I I 1/ \ / '--' I \ \ / \ \ / / I / I / \ I I \ ~ / / /-, ----=--/-...;..,-- --.,..:: ,_~~-----/ -....,,_ ' \ I / / t ,,,/ I I - I / / l \ ' \ -....,,_ ~ /~ ,,---- L ->-.,::::__ ------=-~ ~ - \ \ \ \ \ \ \ ' ( ) I / / I ~ -_____ ,,,,---...__ -- ------- ~ / I / / I / ~ .. ,(J ~ .. --/ .. / / \ \ I I -1-- / I ' \ \ \ \ -----/----/" .,/·· . I• • • / • .• '\_ >-. ~· ~--·. I/ .. ~-l---.-.----/···...;'....--.-,--.-.--'"'·-~J------"---,~-...:·.--.. --, " ________ .l_l.-.--.--.• ---.-.----.• ------.l.----,-.-1---•.·.~---..:,---.-/--/.-.-.-~J.---._:~,_J' . :---:, / /4 ~. / / ;c • \ . • • • • -. •. • -• • • -• --• ' --·-.... , /. .I• • / \' . . •\ . • . ·/ --. • \ . • • . . • < / .. / . /·'. 1\-.. .\ --. J .:.. ➔ ,__ca.-·'"'''---•---.------.;.~--,.--"';....-";:;...;:-.-,c·--&~--;....---,-""--..<'=•--=----,._ ___ ..:-------------~"'_:_ _ __,. __ ,._•'--/ -_'-ca-. c'--c -✓ . \. -,, , '--( .', . ;.;.s . . I •.• •• , ( • •. • a .• -• .-•-. . . • 1/ _,_, ;T . --C ,-----1"'"-"" 7" __ .__,_...;_-11-- . . -. . . . . ' \ \ ' ' ' • ,,,I \ \ ' \ ' . \ ____ ( ~ \ I ' --------------- 0 • / I rr,r, \ \ ) C below all before you·d. 19. \ ) \ \ \ >>>>>>>>>>>>>>>>>>xxxx xxxxxxx5780575 0 57 3 057605770 5790 5760 5790 R20' EXISTING LEECH FIELD EXISTING WELL EXISTING PROPANE TANK PROPERT Y L I N E OUTDOOR STORAGE -2.6:1FFE:5768.16' FFE:5768.26' FFE:5768.76' FFE:5767.76' FFE:5768.26' FFE:5768.76'5768RIM:5768.35' RIM:5767.80' RIM:5768.55'-2.2:1-2.0:1-2.1:1-2.3:1-1.9:1-2.6:1 5762 5764 5780 5770 577057805750 5760 5 7 6 0 5 7 5 0 5784 5782 -3.0:1-2.0:11.0%2.0%2.0% 2.6% 1 0 . 2 % 10.4 %5.0%0.7%2.0%3.2% 1.5% 1.0% TOW:5778.93' TOW:5787.47' TOW:5789.46' TOW:5799.48' BOW:5794.48' BOW:5783.98' BOW:5780.77' BOW:5778.47'57685750 5748 5746 1.0% 2.9%0.0%1.0%1.0%1.0%0.9%1.7%FFE:5782.50' 5 7 6 6 5770 5780 57 5 8 57 5 2 5 7 6 6 5 7 6 4 5764 5760 5756 5752 5768 HWY 6 I-70 I-70 EMPTY FIBER CONDUITS WALL PROFILE 5770 5780 5790 5800 5770 5780 5790 5800 0+00 0+255782.05787.480+505784.05789.480+755792.05799.480+81 5794.0 5799.48 OPRIS ES NGINEERING, LLC. CIVIL CONSULTANTS 19137.01JOB NO. DATE:07-28-22 502 MAIN STREET CARBONDALE, CO 81623 (970) 704-0311 FAX: (970)-704-0313 DESIGNED BY DRAWN BY CHECKED BY AD 01/28/22 AD 01/28/22 YN 07/22/22 DATE REVISION C-3.4 DRAWING NO. TITLE G:\2019\19137\CIVIL\CIVIL DWGS\PLOT\LIMITED IMPACT REVIEW COMPLETLESS\19137 C3.0 GRADING.DWG - Jul 28, 2022 - 7:42amNORTHGRADING AND EROSION CONTROL PLANROYAL MINI STORAGE AT WEST GLENWOODGARFIELD COUNTY, COLORADOLIMITED IMPACT REVIEW1 inch = ft. ( IN FEET ) GRAPHIC SCALE 020 20 40 20 8010 MEMBER UTILITIES FOR THE MARKING OF UNDERGROUND BEFORE YOU DIG, GRADE, OR EXCAVATE CALL 2-BUSINESS DAYS IN ADVANCE .QRZZKDW V 5 SHT C2.3 SHT C2.1 SHT C2.2 30% SLOPE LINE WALL PROFILE SCALE VERTICAL: 1" = 20' HORIZONTAL: 1" = 20' PROPOSED GABION WALL FOR ROCKFALL MITIGATION EXISTING HOME TOP OF WALLBOTTOM OF WALL EXISTING CONDITIONS TOP OF WALL BOTTOM OF WALL SHEET KEY / I /1 I / / / / / I I ;1 / I I I / / / / / / / / I / / / / I I I / / / / \ / I / I I \ \ \ I I I I I I / I / I I ) / / / I I I / (l'-o~ ,r;r----, ,'---:!~ / / / / / / / / / / / / / / I / / / / / / I / / / / / / I I / / / I / I / I / / / I ( / I I I / / I / / / I I I I I / / / I I / I I I I I I I \ I \ I I \ I I I I I I I I I I ; I I I I I I _,, I/; I I I I ; I I / l I \ I \ \ II I I / / II I \ I ~ ' \ - ✓ --£/_~---"~---=~~> Q '- CJ CJ ~ ---0.:: Q 0.:: / CJ o CJ o CJ o QQQQQQ ~Q o~~~" cz_-62~2~ Q Q Q CJ CJ Q ,,-ce: 0 dd~: 2'C:'.f',6-Q~CJ CJ CJ CJ CJ o ~, p~~~~~~-o?B:J~~~~~:oCJo I "' __,,_~rvzf:.''l"'.'k :: '-,,...__-'-A,...__-~"--~An:-~ '-,,...__-CJ CJ Q~: ~ Q ~~'-----A---Q -~~~--~~ CJ ~ CJ CJ CJ CJ CJ CJ CJ CJ CJ CJ CJ CJ CJ CJ \ \ I I \ -I \ ~q"' ~o~~o~q"' ~q ~~CJ~~~~o~q _o "' "' ~ ~~~~~~ "' : "'~ 0 0 I ,:,~1::,~~)\-:Lp~ Q Q Q Q Q Q~~~~ "' "' -~.-re;--: Q Q Q Q , CJ CJJ:)~,6-Qp'-Q G "' ; 5=,_,~-'.3:;=1o---;:,-'=,,-r-___,,,,,.-v----~ o.:: Q o.:: r~:;:,i;ccr,-'s--r-,-'s--r--r "' ~~ \ / ~CJ,,-.__-~~~ -~~~ d~~~~~ q DQ'-6Q'-6~~~~'-6Q'-6~bjY~Q'-OCJ~"'S25~_,;--- CJ cz_-6~6!:J2'-0CJ Q Q 0 • rur, I I I ---- below. Call before you dig. ue ue ueueu e ue ue ue ue ue ue ue ue ueueueueueoe oe oe oe oe oe oe oe oeoe8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL 8''WL 8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL2''WL 2''WL 2''WL 2''WL8''WL 8''WL 8''WL8''WLUEUExxxxxxxxUEUEUEUEA1 A2 A3 A4 A5 A6 A7 OUTDOOR STORAGE EXISTING LEECH FIELD EXISTING WELL SERVING EXISTING HOME PROPERT Y L I N E PROPERTY LINE PROPERTY LINE PROPERTY LINE PROPERTY LINE PROPERTY LINEC1 C2 C3 C4 OUTDOOR STORAGE EMPLOYEE HOUSING OFFICE EXISTING HOME WESTBOUND INTERSTATE 70 HIGHWAY 6&24 EXISTING DIRT ROAD C5 B1 B2 B3 B4 B5 B6 B7 B8C2.1EXISTING OVERHEAD ELECTRIC PROPOSED 8" WATERMAIN FROM TANK EXISTING UNDERGROUND ELECTRIC NEW LOCATION OF UNDERGROUND ELECTRIC PROPOSED FIRE HYDRANT EXISTING DRY HYDRANT EXISTING ELECTRICAL TRANSFORMER EXISTING PROPANE TANK PROPOSED GABION WALL PROPOSED OWTS EXISTING DRIVEWAY REDUCER TO 2" WATER LINE OPRIS ES NGINEERING, LLC. CIVIL CONSULTANTS 19137.01JOB NO. DATE: 502 MAIN STREET CARBONDALE, CO 81623 (970) 704-0311 FAX: (970)-704-0313 DESIGNED BY DRAWN BY CHECKED BY AD AD YN DATE REVISION C-4.0 DRAWING NO. TITLE G:\2019\19137\CIVIL\CIVIL DWGS\PLOT\LIMITED IMPACT REVIEW\19137 C4.0 UTILITY PLAN.DWG - Mar 31, 2022 - 1:38pmNORTHUTILITY PLANROYAL MINI STORAGE AT WEST GLENWOODGARFIELD COUNTY, COLORADOLIMITED IMPACT REVIEW1 inch = ft. ( IN FEET ) GRAPHIC SCALE 075 75 150 75 30037.5 MEMBER UTILITIES FOR THE MARKING OF UNDERGROUND BEFORE YOU DIG, GRADE, OR EXCAVATE CALL 2-BUSINESS DAYS IN ADVANCE .QRZZKDW V 5 04-15-22 02/11/22 02/11/22 04/15/22 PROPOSED WATER TANK 180,000 GALLONS EXISTING WELL TO FILL TANK EXISTING WELL TO SERVE EMPLOYEE HOUSING UNIT WATER SERVICE TO EMPLOYEE HOUSING UNIT PROPOSED FIRE HYDRANT PROPOSED FIRE HYDRANT PROPOSED FIRE HYDRANT I \ \ \ \ '\ \ \ j ~:...-:--------=::.:----------------==--1-------==------------==---L------'~ _____________ _::.:c=======~======1 I 1 \ \ • • C below all before you· dig. 4''SS4''SS4''SS4''SS4''SS4''SSsasvcsasvcsasvcsasvcsasvcsa svc4''SSue ue ue ue ue ue ue ue ueueue ueueueue ue ueueueueueueueueueueoe oe xx8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WL8''WLUEUEUEUEUEUEUEUEUEUEUE xxxxxxxxxxxx xUEUEUEUEUEUEUEUEUEUEUEUEUEUEUEINSTALL 1000 GALLON 2-COMPARTMENT CONCRETE SEPTIC TANK (USE VALLEY PRECAST ITEM # IM 1000-2CP) W/ SEALED RISERS AND LIDS INSTALLED AT THE FINISHED GRADE SURFACE. INSTALL INLET SANITARY TEE AND OUTLET EFFLUENT FILTER SANITARY TEE. DEPTH TO TOP OF TANK FROM PROPOSED GRADE IS APPROXIMATELY 18". EXCAVATION DEPTH 1' MIN.-4' MAX. BELOW SURFACE GRADE MINIMUM. 12" COVER OVER TOP OF CHAMBERS FILL & GRADE FIELD AREA APPROXIMATELY 3"-6" ABOVE EXISTING SURFACE GRADES 4" PVC DISTRIBUTION PIPES (TYP.) 4" PVC EFFLUENT PIPE @ MIN. 1 %, USE SCHD-40 0R SDR-35 ABSORPTION/TREATMENT FIELD USE 44 QUICK-4 CHAMBERS IN 4 TRENCHES WITH 11 CHAMBERS PER ROW FOR A TOTAL ABSORPTION AREA OF 528 S.F. THE SYSTEM SHALL BE PLUMBED FOR EQUAL GRAVITY DISTRIBUTION. THE CHAMBERS SHALL BE INSTALLED ON LEVEL GRADE IN EACH TRENCH. THE BOTTOM OF EACH TRENCH TO BE EXCAVATED TO A MAXIMUM AVERAGE DEPTH OF 36 INCHES BELOW THE EXISTING SURFACE GRADES, WITHIN THE UPPER HORIZON OF THE NATIVE SANDY SILT LOAM SOILS & BACKFILLED WITH A MINIMUM 12-INCHES OF COVER OVER THE CHAMBERS. THE FINISH GRADE ACROSS THE FIELD SHALL BE SLIGHTLY MOUNDED A MINIMUM 6-INCHES ABOVE EXISTING ADJACENT GRADES. CONCRETE DISTRIBUTION BOX WITH BAFFLE INSTALLED LEVEL ON COMPACTED BASE INSTALL RISERS AND LID TO SURFACE 4" PVC SEWER PIPE @ 2%, USE SCHD-40 0R SDR-26 INSTALL 4" RISER PIPE INSPECTION PORT EXTEND RISER W/ PUSH ON CAP MIN. 4" BELOW FINISH GRADE & COVER WITH 6" DIA. VALVE BOX SET WITH LID 1" ABOVE FINSH GRADE (TYP. EACH TRENCH CHAMBER END CAP) INSTALL CHAMBER END CAP ON ALL END CHAMBERS PPROPOSED SOIL PROFILE PIT 4" TWO-WAY CLEANOUT UNDERGROUND ELECTRICAL LINE TO BE MOVED TO ALLOW FOR ABSORPTION FIELD PLACEMENT A1 A2 A3 EMPLOYEE HOUSING UNIT OFFICE BUILDING CARPORT C4 C5 DEBRIS BASIN 2 OPRIS ES NGINEERING, LLC. CIVIL CONSULTANTS 19137.01JOB NO. DATE:04-15-22 502 MAIN STREET CARBONDALE, CO 81623 (970) 704-0311 FAX: (970)-704-0313 DESIGNED BY DRAWN BY CHECKED BY PR 01/17/22 PR YN 04/15/22 DATE REVISION C-4.1 DRAWING NO. TITLE G:\2019\19137\CIVIL\CIVIL DWGS\PLOT\LIMITED IMPACT REVIEW\19137 OWTS DESIGN.DWG - Mar 31, 2022 - 1:39pmNORTHOWTS PLAN 1 inch = ft. ( IN FEET ) GRAPHIC SCALE 020 20 40 20 8010 MEMBER UTILITIES FOR THE MARKING OF UNDERGROUND BEFORE YOU DIG, GRADE, OR EXCAVATE CALL 2-BUSINESS DAYS IN ADVANCE .QRZZKDW V 5 01/17/22 ROYAL MINI STORAGE AT WEST GLENWOODGARFIELD COUNTY, COLORADOLIMITED IMPACT REVIEW==.• ... =.==.=•-~===··.===.S-""'•=""====~-===·.====-~==J..----------------.-.1---.----~.---------1.---------1-..,.---.,..---J------"""'·,...---.. ---,,----.-1 , , ' , , , ' , • • • . • , • • •• • • , • • ~ . . • • • • , • • • • d • • • • A ' , • • cl • ~ d ' • • , • • , • • d .,, • • • • • • • , • / ... • • , • . • •-'-""I"" • .., ,4 £1 __. • 4 .. ----- • A • • , \ • •· , • • ., • ' • , • • • • A Li;, • .....,____ •• ~ • • • • •• • • • , . • • • • • • .. , . , I \ I \ • • ------------ • . . , ff. • • • d • ,. • .. d . • • d • • . ., • • , . • • • \ • • • , • d .. • • , . • ., '° • • • ,• .• • . • • ,· • •· • . . • • • • • • • • ,j • d •• • • A • ,, • • • • . . • . •• : , • • d • , • • • • • . • . .., • . • , • • ' . , • • • . • , .. • . • <' , . ,. • • • • ~ , • • -, • d ~., • ~ ___._ • , • . . -, • ..... . • . . , • • • • • • • • .-• A , • .-.. , 1 • I • • • • --------------------- -------■----------------------1---------------------------------A". 4' C below all before you· d' 19.